KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_05415Help
Entry
PSJM300_05415     CDS       T02182                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSJM300_05415
Enzymes [BR:psj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PSJM300_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1182687..1183733)
Genome map
AA seq 348 aa AA seqDB search
MKGIGSISRKAKRTLAGIALIATGAGAQAEAIDLIGLNIGGAAFAGGIYPGKYKTNYFFP
APDYLQQWKDKGIRTIRFPILWERLQWELNEELNENYASLIDGVLEQAAEHDMRVILDIH
NYARYKKQKIGSEQVPISAYQDLLERIAKRWKDSEGLYAYDIMNEPHGVDEHWPAAAQAG
IDAIRKHDRERPLLIEGNFWSSSYLWRKYNDPLLQLKDPADKLIFSAHLYVDKHGNGLYK
DPLPDDFDTMVGVKRARPFVEWLIEHGRKGHIGEFGVPGDDPRLLKAMDNLLSYLQQHCI
PLNYWAAGKAWGNYKLSVEPKDGKDRPQWAVLEKYVGQGDCQAIGPRG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaataggtagcatttcccggaaagcgaaacggacgctcgccggtatcgcactg
atagccaccggcgcgggtgcgcaggcagaggccatcgacctgataggcctcaacatcggc
ggagccgcgttcgccggcggcatttatcccggcaagtacaagaccaactacttctttccc
gcccccgattacctgcagcaatggaaggacaagggcatacgcaccattcgctttccgatc
ctgtgggaacgcctgcaatgggagctgaacgaggaactgaatgagaattacgcctcgctg
atcgacggggtgctcgagcaggctgccgagcacgacatgcgcgtcatcctcgatatccac
aactacgcacgctacaagaaacagaagatcggctccgagcaggtacccatctcggcctac
caggaccttctcgagcgaatcgccaagcgctggaaggatagcgaggggctctacgcctac
gacatcatgaacgagccccacggcgtggacgaacactggccagccgccgcccaggccggg
atcgatgcgatacgcaagcacgatcgcgagcgcccgctgcttatcgaaggcaacttctgg
tccagcagctacctctggcgcaagtacaacgacccgctcctgcagctgaaggaccccgcc
gacaaactgatcttctcggcgcacctgtatgtcgataagcacggcaacggcctgtacaag
gacccactgccggacgatttcgacaccatggtcggcgtgaaaagagccaggcccttcgtt
gagtggcttatcgaacatggccgtaaaggtcatatcggtgagtttggcgtccccggtgac
gacccccgcctgctgaaagcgatggacaatctcctgtcgtacctgcagcagcattgcata
cccctgaactactgggccgccggcaaggcctggggcaactacaagctctcggtcgagccg
aaggacggcaaggaccgtccccagtgggcagtactcgagaagtacgtcggccaaggcgac
tgccaggcaatcggaccacggggctga

DBGET integrated database retrieval system