KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_05945Help
Entry
PSJM300_05945     CDS       T02182                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291806..1292915
Genome map
AA seq 369 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSSDPNIQVVGTATNGREAIDQALALKPDVITMDYEMPM
MDGITAVRQIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTVSRSNRRYGSHVGTSPAPATTGATAPLGRGRIAPAPSPRGAATPVAAPSAAP
KRKAYRLVAIGTSTGGPVALQRVLTQLPAGFPAPILLIQHMPAAFTKAFAERLDKLCQIR
VKEAEDGDVLRPGLALLAPGGKQMMVDGRGQVRILPGDERLNYRPCVDVTFGSAAKAFQD
KVLAVVLTGMGADGREGARMLKQSGSQIWAQDEASCVIYGMPMAVVKANLADAVYPLDDI
GRHLSEACL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcttggtggtggacgattccggcttcttccgccgccgcgtttcggaa
atcctgtcttcggaccccaatatccaggtggtcggcaccgccactaacggtcgcgaggcg
atcgatcaggcgctggcgctcaagccggacgtgatcaccatggattacgagatgccgatg
atggacggcatcactgccgtgcgacagatcatgcagcgctgcccgacgccggtcttgatg
ttctcttcgctgacgcacgaaggcgcccgcgtcacgctcgatgcgctggatgccggggcg
gtcgactatctgccgaagaacttcgaggatatttcgcgcaatccggacaaggtcaagcag
ctgctgtgcgagaaggtgcataccgtatcgcgcagcaaccgccggtatggcagccacgtc
ggcacttcgcctgcgccggcaaccaccggtgccaccgcgcccctcgggcgtgggcggatc
gcgccagcgccgagtccgcgtggcgccgctacgccggtcgcggcacccagcgccgcgccc
aagcgcaaggcctaccgactggtcgccatcggcacttcgaccggtgggccggttgcgctg
cagcgcgtgttgacgcagctaccggccggttttccggcgccgattttgttgatccagcac
atgccggctgcgttcaccaaggcgttcgccgagcggctggacaagctctgccagattcgt
gtcaaggaagccgaggatggtgacgtgctgcgcccgggcctcgcattactggcccccggc
ggcaagcagatgatggtcgacggacgcgggcaggtgcgtatcctgccgggcgacgaacgc
ctgaactaccgcccttgcgtcgacgtgaccttcggctcggcggccaaggctttccaggac
aaggtgctggcggtggtgctcaccggcatgggcgccgacggccgggaaggcgcgcgcatg
ctcaagcagagcggcagccagatctgggcgcaggacgaagccagctgcgtgatctacgga
atgcccatggcggtggtcaaggccaacctcgcggatgccgtgtaccccctcgatgacatc
ggccgccatctgagcgaggcgtgcctctga

DBGET integrated database retrieval system