KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_05945Help
Entry
PSJM300_05945     CDS       T02182                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSJM300_05945
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSJM300_05945
Enzymes [BR:psj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSJM300_05945
Two-component system [BR:psj02022]
 CheA family
  CheA-CheYBV
   PSJM300_05945
Bacterial motility proteins [BR:psj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSJM300_05945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291806..1292915
Genome map
AA seq 369 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSSDPNIQVVGTATNGREAIDQALALKPDVITMDYEMPM
MDGITAVRQIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTVSRSNRRYGSHVGTSPAPATTGATAPLGRGRIAPAPSPRGAATPVAAPSAAP
KRKAYRLVAIGTSTGGPVALQRVLTQLPAGFPAPILLIQHMPAAFTKAFAERLDKLCQIR
VKEAEDGDVLRPGLALLAPGGKQMMVDGRGQVRILPGDERLNYRPCVDVTFGSAAKAFQD
KVLAVVLTGMGADGREGARMLKQSGSQIWAQDEASCVIYGMPMAVVKANLADAVYPLDDI
GRHLSEACL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcttggtggtggacgattccggcttcttccgccgccgcgtttcggaa
atcctgtcttcggaccccaatatccaggtggtcggcaccgccactaacggtcgcgaggcg
atcgatcaggcgctggcgctcaagccggacgtgatcaccatggattacgagatgccgatg
atggacggcatcactgccgtgcgacagatcatgcagcgctgcccgacgccggtcttgatg
ttctcttcgctgacgcacgaaggcgcccgcgtcacgctcgatgcgctggatgccggggcg
gtcgactatctgccgaagaacttcgaggatatttcgcgcaatccggacaaggtcaagcag
ctgctgtgcgagaaggtgcataccgtatcgcgcagcaaccgccggtatggcagccacgtc
ggcacttcgcctgcgccggcaaccaccggtgccaccgcgcccctcgggcgtgggcggatc
gcgccagcgccgagtccgcgtggcgccgctacgccggtcgcggcacccagcgccgcgccc
aagcgcaaggcctaccgactggtcgccatcggcacttcgaccggtgggccggttgcgctg
cagcgcgtgttgacgcagctaccggccggttttccggcgccgattttgttgatccagcac
atgccggctgcgttcaccaaggcgttcgccgagcggctggacaagctctgccagattcgt
gtcaaggaagccgaggatggtgacgtgctgcgcccgggcctcgcattactggcccccggc
ggcaagcagatgatggtcgacggacgcgggcaggtgcgtatcctgccgggcgacgaacgc
ctgaactaccgcccttgcgtcgacgtgaccttcggctcggcggccaaggctttccaggac
aaggtgctggcggtggtgctcaccggcatgggcgccgacggccgggaaggcgcgcgcatg
ctcaagcagagcggcagccagatctgggcgcaggacgaagccagctgcgtgatctacgga
atgcccatggcggtggtcaaggccaacctcgcggatgccgtgtaccccctcgatgacatc
ggccgccatctgagcgaggcgtgcctctga

DBGET integrated database retrieval system