KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_06095Help
Entry
PSJM300_06095     CDS       T02182                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSJM300_06095
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSJM300_06095
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSJM300_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317424..1317906
Genome map
AA seq 160 aa AA seqDB search
MRDSLLEIPCRTMDGQEKTLADFDGRVWLVVNTASECGFTPQYKGLEALWQRYRDQGLVV
LGFPCNQFGRQEPGDEAQIASFCERNFGVSFPLFSKVDVNGADAHPLFRELKKRAPGLLG
SKAIKWNFTKFLIAEQGASVERFASNTPPQALVERIEALL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgattctttgctcgagattccctgccgcaccatggatggtcaggagaagaccctg
gccgacttcgacggcagggtgtggctggtggtcaataccgccagcgaatgtggtttcaca
ccccagtacaaggggctggaggcgctctggcagcgctatcgggatcagggcctggtcgtg
ctcggtttcccctgcaaccagttcggcaggcaggagccgggtgacgaggcgcagatcgcg
tccttctgtgagcgcaacttcggggtgagctttccattgttctccaaggtggacgtcaac
ggtgccgacgcgcacccgctgttccgcgagctcaagaagcgtgccccggggctgctcggc
agcaaggcgatcaaatggaacttcaccaagttcctgatagccgagcagggggcttcggtg
gagcgtttcgcctccaacacgccgccgcaggcgctggtcgagcgtatcgaagcgctgctg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system