KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_06755Help
Entry
PSJM300_06755     CDS       T02182                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00071  Fatty acid degradation
psj00280  Valine, leucine and isoleucine degradation
psj00281  Geraniol degradation
psj00310  Lysine degradation
psj00362  Benzoate degradation
psj00380  Tryptophan metabolism
psj00410  beta-Alanine metabolism
psj00640  Propanoate metabolism
psj00650  Butanoate metabolism
psj00903  Limonene and pinene degradation
psj00930  Caprolactam degradation
psj01040  Biosynthesis of unsaturated fatty acids
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
psj01212  Fatty acid metabolism
Module
psj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSJM300_06755 (fadB)
   00650 Butanoate metabolism
    PSJM300_06755 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PSJM300_06755 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PSJM300_06755 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSJM300_06755 (fadB)
   00310 Lysine degradation
    PSJM300_06755 (fadB)
   00380 Tryptophan metabolism
    PSJM300_06755 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSJM300_06755 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSJM300_06755 (fadB)
   00281 Geraniol degradation
    PSJM300_06755 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSJM300_06755 (fadB)
   00930 Caprolactam degradation
    PSJM300_06755 (fadB)
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSJM300_06755 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSJM300_06755 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSJM300_06755 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PSJM300_06755 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFN77425
Position
1454809..1456956
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDAIKGDASVKGVIVTS
GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLGVPTVVAINGIALGGGFE
MCLAADYRVMSATAKVGLPEVKLGIYPGFGGTVRLPRVIGVDNAVEWIASGKENRAEDAL
KVHAVDAVVAPEKLQEAALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETSKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKAIEVEAAGFAKLAKTSVAESLVGLFLSDQEL
KKKAKNYDKQAREVKLAAVLGAGIMGGGIAYQSAIKGTPILMKDIREEGIQMGLDEASKL
LGKRVEKGRMTPAKMAEALNAIRPTTSYGDFGNVDIVVEAVVENPKIKQAVLAEVEGLVR
EDAIIASNTSTISISLLAQALKRPENFCGMHFFNPVHMMPLVEVIRGEKTSETAIATTVA
YAKKMGKSPVVVNDCPGFLVNRVLFPYFGGFARAIAHGVDFVRADKVMEKFGWPMGPAYL
MDVVGMDTGHHGRDVMAEGFPDRMKDDSKTAVDVMYEANRLGQKNGKGFYAYEVDKKGKP
KKVVDPQSYELLKPIVSETRELSDEDIINYMMIPLCLETVRCLEDKIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGPLYHPTAKLREMAANGQRFYG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaagttcaaccgcctcaccctcaatgaactg
cgccaggctgtcgatgccatcaagggcgacgcttcggtcaagggcgtcatcgtcaccagc
ggcaaggacgtgttcatcgtcggcgccgacatcaccgaattcgtcgacaacttcaagctc
ccggacgaggaactggtcgccggcaacctcgaagcgaacaagatcttcagtgatttcgaa
gacctgggcgtgcctaccgtcgtcgccatcaacggtatcgccctgggtggcggtttcgag
atgtgcctggcggccgattaccgtgtcatgtccgccaccgccaaggtcggcctgccggaa
gtcaagctgggcatctacccgggcttcggcggcaccgtgcgcctgccgcgcgtgatcggt
gtcgacaacgccgtcgagtggatcgcctcgggcaaggaaaaccgcgccgaagacgccctg
aaagtacatgccgtcgatgccgtggtcgcgccggagaagctgcaggaagctgcgttggac
ctggtcaagcgcgccatttccggcgagctggactacaaggccaagcgtcagccgaagctg
gaaaagctcaagctcaacgccatcgagcagatgatggccttcgagacctccaagggcttt
gtcgccggccaggccggtccgaactacccggcgccggtcgaagccatcaagaccattcag
aaagcggccaacttcggtcgcgacaaggccatcgaagtcgaggctgccggcttcgccaag
ctggccaagacctcggtcgccgagagcctggtcggcctgttcctcagcgaccaggaactg
aagaagaaggccaagaactacgacaagcaggcccgtgaagtgaaactggccgccgtgctg
ggcgccggcatcatgggtggcggcatcgcctaccagtcggccatcaagggcacgccgatc
ctgatgaaggatatccgcgaggaaggcatccagatgggcctggacgaggcgtccaagctg
ctcggcaagcgcgtcgagaagggtcgcatgaccccggcgaagatggccgaagccctcaat
gcgattcgcccgaccacttcctatggtgatttcggcaacgtcgacatcgtcgtcgaggcc
gtggtcgagaatccgaagatcaagcaggctgtgttggccgaagtggaaggcctggtgcgt
gaagacgcgatcatcgcctccaacacctcgaccatctccatcagcctgctggcccaggcg
ctcaagcgtccggaaaacttctgcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtcatccgtggcgagaagaccagcgaaaccgccatcgccaccaccgtcgcc
tacgccaagaagatgggcaagagcccggtcgtggtcaacgattgcccgggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggtttcgcccgtgccatcgcccacggtgtcgac
ttcgtacgcgccgacaaggtgatggagaagttcggctggcccatgggcccggcttacctg
atggacgtcgtcggcatggacaccggccaccacggccgtgacgtgatggccgaaggcttc
ccggatcgcatgaaggacgacagcaagaccgcggtcgacgtcatgtacgaggccaaccgc
ctgggccaaaagaacggcaagggcttctacgcctatgaagtggacaagaagggcaagccg
aagaaggtcgtcgacccgcagtcctacgaactgctcaagccgatcgtcagcgagacccgc
gagctgtccgacgaggacatcatcaactacatgatgatcccgctgtgcctggaaaccgtc
cgctgcctggaagacaagatcgtcgaaaccgccgccgaagccgacatgggcctcatctat
ggcatcggtttccctcccttccgtgggggtgcactgcgctacatcgattcgatcggtgtc
gccgagttcgtggcgctggcggacaagtacgccgacctgggcccgctgtaccacccgact
gcgaagctgcgtgaaatggctgccaacggccagcgcttctacggttaa

DBGET integrated database retrieval system