KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_06810Help
Entry
PSJM300_06810     CDS       T02182                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:psj00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:psj00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465970..1466965
Genome map
AA seq 331 aa AA seqDB search
MQGSLMLDIAGTWLTAEDRQLLRQPEVGGLILFARNIENPRQVRELCRAIRAIRPDLLLA
VDQEGGRVQRLRRDFVRLPAMREFAQRADALQLAETCGWVMATEVQAVGLDFSFAPVLDL
DHQRSAVVGTRAFEGDPLRAAELAGAFMKGMRAAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDQLRSADLIPFKRLSSELDAVMPAHVIYPNVDEQPAGFSRRWLHDILRGELGFRGV
IFSDDLSMAGAHVAGNAAERIQAALSAGCDMGLVCNDRAAAELALAALQRMGVVPSPQLG
RMRSRLDTSPEYKQNPRWRASIAALRAAELL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggttcattgatgctggacatcgctggcacctggctgaccgccgaggatcgccaa
ctgctgcgccagccggaagtcggcggactgattctgttcgcccgcaatatcgagaaccct
cgccaggtacgcgagttgtgccgcgcgatccgcgcgatacggccggacctgctgctggcg
gtcgatcaggaagggggccgggttcagcggttgcggcgtgatttcgttcgtttgccggcg
atgcgcgagttcgcccagcgtgccgatgcactgcaactggccgaaacctgtggctgggtc
atggcgacggaagtgcaggcggtggggctggatttcagctttgcgccggtgctggacctg
gatcatcagcgcagcgcggtggtcggcacgcgggcgttcgagggcgatccgctgcgtgct
gccgagctggcaggcgccttcatgaaaggcatgcgtgctgccggtatggccgccacgggc
aaacattttccggggcacggttgggcggaagccgactcccatgtagcgatcccggtggac
gaacgcagcctggatcaactgcgctcggccgatctgatcccgttcaagcgcctgagcagc
gaactcgacgccgtcatgccggcgcacgtgatctatccgaacgtcgacgagcagccggct
ggtttttcgcgccgctggctgcacgacatcctgcgtggcgagctgggatttcgtggcgtc
atcttcagcgacgacctgtccatggccggtgcccatgtggcggggaatgcggccgagcgc
atccaggcggcgctgtcggccggctgcgacatggggctggtgtgcaacgaccgggccgcg
gccgagctggcgttggccgcactgcaacgtatgggcgtcgtgccttcgccgcagctgggc
aggatgcgcagccgtctcgatacctcgcccgagtacaagcagaatcctcgctggcgcgct
tccatcgccgcgctgagagctgccgagctgctttga

DBGET integrated database retrieval system