KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_06810Help
Entry
PSJM300_06810     CDS       T02182                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSJM300_06810
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PSJM300_06810
Enzymes [BR:psj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSJM300_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1465970..1466965
Genome map
AA seq 331 aa AA seqDB search
MQGSLMLDIAGTWLTAEDRQLLRQPEVGGLILFARNIENPRQVRELCRAIRAIRPDLLLA
VDQEGGRVQRLRRDFVRLPAMREFAQRADALQLAETCGWVMATEVQAVGLDFSFAPVLDL
DHQRSAVVGTRAFEGDPLRAAELAGAFMKGMRAAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDQLRSADLIPFKRLSSELDAVMPAHVIYPNVDEQPAGFSRRWLHDILRGELGFRGV
IFSDDLSMAGAHVAGNAAERIQAALSAGCDMGLVCNDRAAAELALAALQRMGVVPSPQLG
RMRSRLDTSPEYKQNPRWRASIAALRAAELL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggttcattgatgctggacatcgctggcacctggctgaccgccgaggatcgccaa
ctgctgcgccagccggaagtcggcggactgattctgttcgcccgcaatatcgagaaccct
cgccaggtacgcgagttgtgccgcgcgatccgcgcgatacggccggacctgctgctggcg
gtcgatcaggaagggggccgggttcagcggttgcggcgtgatttcgttcgtttgccggcg
atgcgcgagttcgcccagcgtgccgatgcactgcaactggccgaaacctgtggctgggtc
atggcgacggaagtgcaggcggtggggctggatttcagctttgcgccggtgctggacctg
gatcatcagcgcagcgcggtggtcggcacgcgggcgttcgagggcgatccgctgcgtgct
gccgagctggcaggcgccttcatgaaaggcatgcgtgctgccggtatggccgccacgggc
aaacattttccggggcacggttgggcggaagccgactcccatgtagcgatcccggtggac
gaacgcagcctggatcaactgcgctcggccgatctgatcccgttcaagcgcctgagcagc
gaactcgacgccgtcatgccggcgcacgtgatctatccgaacgtcgacgagcagccggct
ggtttttcgcgccgctggctgcacgacatcctgcgtggcgagctgggatttcgtggcgtc
atcttcagcgacgacctgtccatggccggtgcccatgtggcggggaatgcggccgagcgc
atccaggcggcgctgtcggccggctgcgacatggggctggtgtgcaacgaccgggccgcg
gccgagctggcgttggccgcactgcaacgtatgggcgtcgtgccttcgccgcagctgggc
aggatgcgcagccgtctcgatacctcgcccgagtacaagcagaatcctcgctggcgcgct
tccatcgccgcgctgagagctgccgagctgctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system