KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_07315Help
Entry
PSJM300_07315     CDS       T02182                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSJM300_07315 (ruvA)
Enzymes [BR:psj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PSJM300_07315 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1570708..1571313
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPALGEPVTLHTHLVVREDAQLL
YGFAEKRDRELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSVLVKIPGVGKKT
AERLLVELKDRFKAWENMPSIAPLVVEPRANVAVSSAENDAVSALISLGFKPQEASRAVS
AVQEDDLSSEDLIRRALKGMV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggctgagaaacagccgccacatttgattctggat
gtaaacggcgtcggctatgaagtcgaggtgccgatgaccacgctttaccgtttgccggcg
cttggcgagccggtgacgctgcacacccacctggtggtgcgtgaagatgcacagctgctc
tacggctttgccgaaaagcgcgaccgtgagctgttccgcgagctgatccgcctcaatggc
gtgggccccaagctggcgctggcgctgatgtccggactcgaagtggatgagttggtgcgt
tgtgtacaggcgcaggatacttccgtgctggtgaagataccgggagtcggcaagaagacg
gccgagcgcttgctggtcgagctcaaggatcgcttcaaggcctgggagaacatgccgtcc
atcgcgcctctggtggtggaaccccgggcgaatgtggcagtctcaagcgccgagaatgat
gcggtcagtgcgctgatttccctcggtttcaaaccccaggaggccagccgtgccgtttcc
gccgtacaggaagacgatttgagcagtgaagacctgatccgccgtgcactcaagggaatg
gtgtag

DBGET integrated database retrieval system