KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_07315Help
Entry
PSJM300_07315     CDS       T02182                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1570708..1571313
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHLILDVNGVGYEVEVPMTTLYRLPALGEPVTLHTHLVVREDAQLL
YGFAEKRDRELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSVLVKIPGVGKKT
AERLLVELKDRFKAWENMPSIAPLVVEPRANVAVSSAENDAVSALISLGFKPQEASRAVS
AVQEDDLSSEDLIRRALKGMV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggctgagaaacagccgccacatttgattctggat
gtaaacggcgtcggctatgaagtcgaggtgccgatgaccacgctttaccgtttgccggcg
cttggcgagccggtgacgctgcacacccacctggtggtgcgtgaagatgcacagctgctc
tacggctttgccgaaaagcgcgaccgtgagctgttccgcgagctgatccgcctcaatggc
gtgggccccaagctggcgctggcgctgatgtccggactcgaagtggatgagttggtgcgt
tgtgtacaggcgcaggatacttccgtgctggtgaagataccgggagtcggcaagaagacg
gccgagcgcttgctggtcgagctcaaggatcgcttcaaggcctgggagaacatgccgtcc
atcgcgcctctggtggtggaaccccgggcgaatgtggcagtctcaagcgccgagaatgat
gcggtcagtgcgctgatttccctcggtttcaaaccccaggaggccagccgtgccgtttcc
gccgtacaggaagacgatttgagcagtgaagacctgatccgccgtgcactcaagggaatg
gtgtag

DBGET integrated database retrieval system