KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_08325Help
Entry
PSJM300_08325     CDS       T02182                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1788461..1789513)
Genome map
AA seq 350 aa AA seqDB search
MKSLSLRHFVRAARLGLVAMLAASQLATASDEQPGIDLIGVNLSGAGFAPHVVPGKVGQH
YFYPEKQHFAYYRDKNIRLIRFPFLWERVQHDLYKGLNTQQLRLLEQTLDLAQEHGQKVI
LDMHNYGRYQGELIGTRKVPYEAYAKVWRKLAERFRDHPALHGYDIMNEPHGTAGLWPGA
AQAAVNAIREVDSKTLIFVEGDRWASAYHWPSANANLLIDDPTGNIVYEAHLYLDEDTSG
RYQRADYSDVDPMLGVERARPFVEWLKKHGKKGFLGEYGVPGNSEPLLVAMNNLLAYLNE
NCIPSAYWAGGPGWGDYVMAIEPRDGEDRPQMRVLQQNLNNDCAKYGPHS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagtctttccctccggcatttcgttcgtgccgcccggctcgggctggtggccatg
cttgccgcctcccagctagccaccgcgtcggacgaacaaccgggtatcgatctgatcggc
gtcaatctgtcgggcgccggcttcgcgccgcacgtggtgccgggcaaggtcgggcagcac
tatttctatcccgagaagcaacacttcgcgtactaccgcgacaagaacattcgcctgatt
cgcttcccctttctctgggagcgagtccagcacgatctgtacaagggcctgaatacccag
cagcttcgcctgctggagcagaccctggatctggcacaggagcatggccagaaagtcatt
ctcgacatgcacaactatggtcgttatcagggtgagctgatcggcacacgaaaagtgccc
tacgaggcctatgccaaggtgtggcgcaagctggccgagcgcttcagggaccaccctgcc
ctgcacggctacgacatcatgaacgagccccacggcacggccgggctctggccgggcgcg
gcgcaggcggcggtgaacgccatccgtgaggtcgacagcaagacgctgatcttcgtcgaa
ggcgatcgctgggccagcgcctatcactggcccagcgcgaacgccaatctcctgatcgac
gaccccaccggcaacatcgtctacgaagcccatctctacctcgacgaggacacctcgggt
cgctaccagcgcgccgactattccgacgtggatccgatgctcggcgtcgagcgggcgcga
cccttcgtcgagtggctgaagaagcacggcaagaaaggcttcctcggcgaatacggcgtg
cccggcaactccgagccgttgctggtggccatgaacaacctgctggcctacctgaacgag
aactgcatacccagcgcctattgggccggcggccctggctggggcgattacgtcatggcc
atcgagccacgcgacggcgaggaccgtccgcagatgcgtgtcctccagcagaacctgaac
aacgactgtgccaaatatggcccgcattcctga

DBGET integrated database retrieval system