KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_09570Help
Entry
PSJM300_09570     CDS       T02182                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSJM300_09570
Enzymes [BR:psj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PSJM300_09570
Exosome [BR:psj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSJM300_09570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072157..2074373
Genome map
AA seq 738 aa AA seqDB search
MNDRPVVTLPGEQLLPSDGDVDALVRAEHGDPFSILGPHPDGDGLVVRAYLPNALGVEVL
ERASGRMLGTMEQGQVPGLFFTRLTHPQPYLLKIRWAGGEHVTEDPYSFGPQLGEMDLYL
FAEGNHRELARVFGAQPMEIDGVQGVRFAVWAPNARRVSVVGSFNDWDGRRHPMRLRFPA
GVWEIFIPHLQPGDAYKYEILGPDGVLPLKADPMALATEHPPGTASVIARPLDYEWKDEY
WLQERAARQSLEAPMSIYELHAGSWQREGGEGGRSYNWHELAERLIPYIGEMGFTHIELM
PIMEHPFGGSWGYQLLSQFAPSARYGSAHDFAAFVDACHAAGIGVILDWVPAHFPTDAHG
LGMFDGTALYEYAHPFEGFHQDWDTYIYNLGRTEVHGFMLASALHWLREFHVDGLRVDAV
ASMLYRDYSRNEGEWIPNRHGGRENLEAIEFLRHLNDVVALEAPGALVIAEESTAFPGVS
KPVADGGLGFSYKWNMGWMHDSLKYIQEDPIHRSYHHDKMTFSMVYAYSEHFVLPISHDE
VVHGKGSLIGKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGSEFGQWREWHHDRELDWH
LLGEPDHKGAQDLVRDLNRLYREEPALHELDSVPAGFQWLIGDDRSNSTFAWLRRSSSGH
PLLVVANFTPVVRENYRVGVPAGGHWLEIFNSDAARYGGSNTGNGAGVLTEEVERHGQSV
SLSLILPPLGVVILRPQA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcggccggtggtgaccctgcccggtgaacaacttttgcccagcgacggcgat
gtcgatgcgctggttcgcgccgagcatggtgatccgttttcgattctcggtccccatccg
gatggcgacggcctggtggtgcgtgcctacctgcccaacgcgctgggcgtcgaggtgttg
gagcgtgccagtggccgtatgctgggaaccatggagcagggccaggtgccggggctgttc
ttcacgcgcctgacccacccacagccctatctgctgaagatccgctgggccggtggcgaa
cacgtcaccgaggacccctacagcttcggtccgcagctgggggagatggacctgtacctg
ttcgccgaaggcaaccatcgcgagctggcccgtgtgttcggcgcgcaaccgatggagatc
gatggggtgcagggcgtgcgcttcgcggtctgggcgcctaacgcgcggcgtgtatccgtg
gtgggcagcttcaacgactgggacgggcggcggcacccgatgcgcctgcgttttccggcg
ggcgtgtgggaaatcttcattccgcacctgcaaccgggcgatgcctacaagtacgagatt
ctcggtcccgacggtgtcctgccgctgaaggccgaccccatggcgctggcgaccgaacat
ccgccgggcaccgcttcggtgatcgcgcgaccgctcgattacgaatggaaggacgaatac
tggctgcaggagcgggcggcacgccagtcgctcgaggcgccgatgtccatctacgagctg
catgccggttcctggcagcgcgagggcggcgagggcgggcgttcgtacaactggcacgag
ctggccgaacgcctgattccctacatcggcgaaatgggtttcacccatatcgagctgatg
ccgatcatggagcatcccttcggcggttcctggggctaccagctgctttcgcagttcgcc
cccagcgcgcgttacggctcggcccatgacttcgccgccttcgtcgatgcctgccacgcg
gcgggtatcggggtgatcctcgactgggtgccggcgcattttcccaccgacgcccatggc
ctcggcatgttcgatggcacggcgctgtacgagtacgcccatcctttcgagggcttccac
caggactgggacacctacatctacaaccttggtcgcaccgaggtgcacggcttcatgctg
gcctcggcgctgcactggttgcgtgagttccatgtcgacggcctgcgcgtggatgccgtg
gcttcaatgctctaccgcgactactcgcgcaacgaaggcgagtggattcccaaccgccac
ggcgggcgcgagaacctcgaagccatcgaattccttcgccacctgaacgacgtggtcgcg
ctggaggcgccgggtgcgctggtcatcgccgaggaatccacggcctttcccggcgtgagc
aagcctgtcgccgacggcggcctgggtttctcctacaaatggaacatgggctggatgcac
gacagcctcaagtacatccaggaagacccgatccatcgtagctatcaccacgacaagatg
accttcagcatggtctacgcctattcggagcacttcgtgctgccgatctcccacgacgag
gtggtacacggcaaaggctcgctgatcggcaagatgcccggcgatcgctggcagaagttc
gccaacctgcgggcctatctctcgttcatgtggacccatcccggcaagaagctgctgttc
atgggctccgagttcggccaatggcgcgaatggcaccatgaccgcgaactggactggcac
ctgctcggcgagcccgatcacaagggcgcccaggacctggtgcgcgatctcaaccgcctg
taccgcgaggaaccggcgctgcacgaactggacagcgtccccgccggcttccagtggctg
atcggcgatgaccgcagcaacagcaccttcgcctggttgcgcagaagctccagcggccat
cccttgctggtggtggccaacttcacgcccgtggtacgcgagaactatcgcgtcggcgtg
ccggcaggagggcactggctggaaatcttcaacagcgacgcggctcgttatggcggctcc
aacaccggcaacggcgcaggagttctgacggaggaggtcgaacgccacgggcagtcggtt
tctttgtcattgatcttgccgcccctgggcgtggtgattcttcgaccgcaggcgtga

DBGET integrated database retrieval system