KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_09655Help
Entry
PSJM300_09655     CDS       T02182                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSJM300_09655
Enzymes [BR:psj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSJM300_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092448..2094526)
Genome map
AA seq 692 aa AA seqDB search
MSDERLEHLARAAGLSIDWIDADGRDQRVQPQVLRDVLTGLGLTAETDEDIEQSLEKLHL
GHQAADLPPLITADQGVPLSLEDFCDAHTPYQLQLEQGSRQTGELDAHAHLAAIDVPGYH
QLQIAGQQLTLAVAPPACPSVEDIAGQSAWGITVQLYSLRRPGDGGLGDTLALEALARSA
AANGAAALGISPLHAMFVGRGEQYSPYSPSSRLFYNVLHAAPGAILGEEPLRLAIEACGL
EAQLRQLEALDLIDWAAVTETRQCLLRTLYEHFMTGGNALQQDFASFREAGGEALENHCR
FEALHATLLDENGYLQHWRQWPERYRTPENPAVQRFAEENADEVSFYAFCQWLIARGLER
AQAAARGAGMAIGLISDLAVGADGGGSQAWSRQDEVLAALSVGAPPDILNRNGQSWGIAA
FSPWGLKAHGYRAFIEMLRANLAHAGGMRIDHVMGLMRLWVTPVGAGPEHGAYLNYPFDD
MLRLLTLEAWRHNAVILGEDLGTVPEGLREKLVARRILGMRVLLFERDGNARFTPASEWS
ADALATTTTHDLPTLRGWWCGHDIDWRIRVGQNREEDRQQQTEERGRERRGLNAVLRPYA
TEFSEELLDPMSAVQASACFVGHTPAPLVLLPMEDVLALEEQPNMPGTIDEHPNWRRRYP
GDSATLLDHPDSARRLQCLAEARRQARGEKPR
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgagcgcctcgaacacctggcaagggcggctgggctgtccatcgactggatc
gacgccgacggccgcgaccagcgcgtgcagccgcaggtattgcgcgacgtgctcacgggt
ctgggcctgaccgccgaaacggacgaagacatcgagcaaagcctggagaaacttcacctt
ggccaccaagctgctgacctgccgccgctgatcacggcggaccagggcgttccgctgagt
ctggaggatttctgcgacgcccacacgccttaccagctgcagctcgaacagggttcccgg
cagacgggcgagctggatgcccatgctcacctggccgccatcgacgtgcccggttaccac
cagttgcagatcgccgggcagcagctgactctcgccgtcgcgccaccggcctgccccagc
gtggaggacatcgccggccaatcggcctggggcatcaccgtccagctctacagtctgcgg
cgccccggcgatggcggcctgggcgataccctggcactggaagccctggcacgcagtgcc
gcggcaaacggcgcggccgcgctgggcatcagcccgctgcacgcgatgttcgtcgggcgc
ggcgagcagtacagcccctattcgccctccagccggcttttctacaacgtgctgcacgcc
gcgccgggcgccatcctcggcgaagaaccgttgcgcctggccatcgaagcctgcgggctc
gaggcgcagctgcggcaactcgaagcgctcgatctgatcgactgggcggccgtgaccgag
acgcggcagtgcctgctgcgcacgctctacgaacacttcatgaccggcggcaatgccctg
cagcaggacttcgccagcttccgcgaggccggcggcgaggcgctggagaaccattgccgg
ttcgaagccctgcacgccaccctgctcgacgagaacggttacttgcagcattggcggcaa
tggcccgagcggtaccgcacgccggaaaatccggccgtgcagcgcttcgccgaggaaaac
gccgacgaagtgagcttctacgcattctgccagtggctcatcgcccgcggcctggaacgt
gcacaagcggcggcgcgcggcgcgggcatggccatcgggctgatcagcgacctggcggtg
ggcgccgacggtggtggcagccaggcctggagccggcaggacgaagtgctggccgccctg
agcgtgggcgcgccaccggacatcctcaatcgcaacgggcaaagctggggcattgccgcc
ttctccccctggggactcaaggcccatggctaccgtgccttcatcgagatgcttcgcgcc
aacctcgcccacgctggcggcatgcgcatcgaccacgtgatggggctgatgcggctgtgg
gtgacgccggtcggtgccggccccgagcatggcgcctacctcaactatcccttcgacgac
atgctgcgcctgcttacgctcgaggcctggcgccacaacgcggtgatccttggcgaagac
ctgggcacggttcccgagggcctgcgcgaaaaactcgtcgcgcggcgaatcctcggcatg
cgcgtactgttgttcgagcgggacggcaacgcgcgcttcacaccggccagcgaatggtcg
gcggatgcgctggcgaccaccaccacccacgatttgccgaccctgcggggctggtggtgc
gggcatgacatcgactggcgcatccgcgtagggcagaaccgcgaggaagatcgccagcag
cagaccgaggagcgcggccgggaacgccgggggttgaacgccgtgctgcgtccatacgcg
accgagttctcggaagagctgcttgacccaatgagtgcggtccaggccagcgcctgcttc
gtcggtcataccccggcgccgctggtgctgctgccgatggaagacgtactggcgctggag
gagcaaccgaacatgcccggcaccatcgacgaacaccccaattggcgacggcgctacccc
ggcgacagcgccacgctgctcgaccacccggacagcgcccggcgcctgcaatgcctggcc
gaagcgcgccgccaggcacgaggagagaaaccgcgatga

DBGET integrated database retrieval system