KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_09770Help
Entry
PSJM300_09770     CDS       T02182                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSJM300_09770
   00052 Galactose metabolism
    PSJM300_09770
   00500 Starch and sucrose metabolism
    PSJM300_09770
   00520 Amino sugar and nucleotide sugar metabolism
    PSJM300_09770
Enzymes [BR:psj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSJM300_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2117035..2117874)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLNQIAVVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIYRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFELIEQTEPGKGGEIQITDALMRQAQD
GCVLAYKFKGQRFDCGSAEGYIEATNFCYENFYLTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctttttcctgcggccggatatggcacgcgattccttcctgcaacc
aaggcgatgcccaaggaaatgctgccggtagtgaacaaacccctgattcagtatggggtc
gaagaggcattggcggccggactcaaccagattgccgtggtcaccggccgaggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctcgaacaccagattcgcaacaccgac
aaggagaaatacctggtcggcatccgccgcctcatcgacgagtgcagcttttcctatacc
cgccaggtggaaatgaaagggcttggccacgccattctcagcggccgcccgctgatcggc
gacgagccgttcgccgtggtactggccgatgacctgtgcatcaacctcgacggcgatccg
gtgctggcgcagatggtcaagctgtacaaccagttccgctgctccatcgtcgcgatccag
gaagtcccgccggaggagaccagcaagtacggtgtgatcgccggcgagatgatccgcgac
gacatctaccgcgtcagtcacatggtcgagaagcccaagcccgaagatgcaccttccaat
ctcgccatcattggccgctacatcctgacgccggacatcttcgagctgatcgagcagacc
gagcccggcaagggcggtgaaatccagatcaccgacgcactgatgcgccaggcccaggac
ggttgcgtgctggcgtacaagttcaagggacagcggttcgattgcggtagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaatttctacctcaccggcaaggcattctga

DBGET integrated database retrieval system