KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_10445Help
Entry
PSJM300_10445     CDS       T02182                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PSJM300_10445
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_10445
  Lipid metabolism
   00071 Fatty acid degradation
    PSJM300_10445
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSJM300_10445
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSJM300_10445
   00626 Naphthalene degradation
    PSJM300_10445
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSJM300_10445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2286092..2287120)
Genome map
AA seq 342 aa AA seqDB search
MDTTMKAAVVRAFGQPLVIEEVAVPRPGPGQVLMKVEACGVCHTDLHAAEGDWPVKPEPP
FIPGHEGVGHVVAVGAGVTHVREGDRIGVPWLYSACGHCVHCLGGWETLCETQQNTGYSV
NGSFAQYVVADANYVGLLPQSIGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYAKAMGLNVAAVDIDDSKLRLAERLGAQLTVNALTTDPAAFIKKEIGGAHGALV
TAVSPKAFAQAAGMLRRGGTMSLVGLPPGDFPLDIFGMVLNGITVRGSIVGTRLDLQESL
EFAAQGKVGATVATDRLENINAIFAHMHKGEIEGRIVLDMTL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaccatgaaagccgccgtggtacgtgccttcggacaaccgctggtgatcgag
gaggtcgcggtgccacgaccggggccggggcaggtgctgatgaaggtcgaagcctgtggg
gtctgccataccgacctgcacgccgctgagggtgattggccggtaaaacctgagccgccc
ttcatccctggccacgagggcgtcggccacgtggtggcggtgggcgcgggcgtcacgcat
gtacgcgaaggcgaccgtatcggcgtaccgtggctgtattcggcctgcggccactgtgtg
cattgtctcggcggctgggaaacactgtgcgaaacgcagcagaacaccggctattcggtc
aacggcagcttcgcccagtacgtggtggccgatgccaactatgtcggtctgctgccccag
agcatcggtttcgttgagatcgcgccggtgctatgcgccggcgtgaccgtctacaagggt
ctgaaggtcaccgacaccaagccaggcgactgggtggtgatctccggcatcggtgggctc
ggccacatggcggtgcagtatgccaaggccatgggcctgaacgtggcggcggtcgatatc
gacgacagcaagctgcgcctggctgaacgcctcggcgcccagctcacggtcaatgcgctc
actacagacccggctgccttcatcaagaaagaaatcggcggtgcacacggtgcgctggtc
actgcggtatcaccgaaagccttcgcccaggccgccggcatgctgcgtcgtggcggcacg
atgtcgttggttgggctgccgccaggggacttcccgctggacatcttcggcatggtgctc
aatggcatcaccgtgcgcggttcgatcgttggcacccggctggatctgcaggagtcactt
gagttcgcagcgcaaggcaaagttggcgccactgtcgccacggatcgcctggaaaacatc
aatgcgatctttgcacacatgcacaagggtgagattgagggccgcatcgtgctcgatatg
acgctgtag

DBGET integrated database retrieval system