KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_10765Help
Entry
PSJM300_10765     CDS       T02182                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSJM300_10765
Enzymes [BR:psj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PSJM300_10765
Peptidases [BR:psj01002]
 Cysteine Peptidases
  Family C44
   PSJM300_10765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2358247..2360100
Genome map
AA seq 617 aa AA seqDB search
MCGIAGWLDYSLDMQMQQDTLQQMTDTMARRGPDAGGLWLDGPIGLGHRRLSIIDLAGGR
QPMLARQDDGREAAAITYSGEIYNYRELRAELQVRGHRFENHSDTEVALRAYLEWGEGFV
DHLNGMFAFALWDLRSQRLLLVRDRMGVKPLYYYQTANGVLFGSEPKALLANARVPRKVR
ADGLREILEMVKTPGHAVFDGMREVLPGELIRIDRQGVSRRRYWQLEAREHAHSLEQTVR
HTRDLLEDIVERQIVSDVPLCSLLSGGLDSSIITALASRKLLAGGKGNIRSFSVDFRDHG
NGFASDAVRGTPDAPFVRELVERIGSSHNEIVLDSHELADPALRSQVVRALDLPPAYWGD
MWPSLYRLFQEVRRHSTVALSGESADEVFGGYRWFHDPTAIEAPTFPWLASVTGRYFDGK
TLFDGGLLRQLDMPGFLADSYSQAIAETPVLPGESPVERRMREMSYLNLTRFVQTLLDRK
DRMSMAVGLEVRVPFCDHRLVEYAFNIPWQMKAFDGREKSILRAATRDLLPESIVDRVKS
PYPSTQDPAYEQALRTSLATIMADPGAPVRELLDPARVKETLGRPLGGLSPMYDRMGMEL
AVGLNTWLTEQDISLDL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgcgggatggctggactacagcctcgatatgcagatgcaacaggacacc
ctgcagcagatgaccgacaccatggcccgacggggccccgatgccggaggcctgtggctg
gacggccccatcggactggggcatcgccggctgtcgatcatcgacctggcgggcggtcgg
cagccgatgctcgcccgccaggacgatgggcgggaagcggcggccatcacctacagcggc
gagatctacaactatcgcgagcttcgggccgagcttcaggtgcgcggtcatcgcttcgag
aatcacagcgacaccgaggtcgccctgcgcgcctacctcgaatggggcgagggcttcgtc
gatcaccttaacggcatgttcgcctttgcgctatgggacctgcgcagccagcgactgctg
ctggtgcgcgaccgcatgggcgtcaagccgctgtactactaccagacggccaacggcgtg
ctcttcggctccgagcccaaggcgctgctggccaatgcgcgggttccacgcaaggtccgc
gccgacgggctgcgcgagatcctggagatggtcaagacaccggggcatgcggtgttcgac
ggcatgcgcgaggttcttccgggcgagctgatacgcatcgaccgccagggcgtttcccgc
cgccgctactggcagctcgaggcacgcgagcatgcgcactccctcgagcaaaccgtccgt
catacgcgagacctgctcgaggatatcgtcgagcgacagatcgtctccgacgttcccctg
tgcagcctgctgtccggtggcctcgactcgtcgatcatcacggcgctggcctcgcgtaaa
ctgctcgcgggcggcaagggcaacatccgctccttctcggtcgacttccgcgatcatggc
aacggctttgccagcgacgcggtgcgcggcacgcccgatgcgcccttcgtgcgggagctg
gtcgagcgcatcggctccagccacaacgagatcgtcctcgacagtcacgagctcgccgac
ccggcacttcgcagccaggtcgtacgggcgctcgacctaccgccggcctactggggcgac
atgtggccatcgctctaccggctgttccaggaggtgcgcaggcactcgaccgttgccctg
tccggcgaaagcgccgacgaggtattcgggggctatcgctggttccatgaccccacggcg
atcgaggccccgaccttcccctggctggcatcggtaacgggtcggtacttcgacggaaag
acgctgttcgacggcggactgctgcgccagctcgacatgccgggctttctggccgacagc
tacagccaggccatcgccgagacgcccgtgttgcccggggaaagccccgttgaacggcgc
atgcgcgagatgagctacctgaacctgacgcgcttcgtgcagacgctcctggatcgcaag
gaccgcatgagcatggccgtcggcctggaggtccgggtaccgttctgcgaccacaggctg
gtcgaatacgccttcaacatcccgtggcagatgaaggcattcgacggtcgtgagaagagc
atcctgcgcgccgcgacccgcgacctgctgccagagtccatcgtcgatcgggtcaagagc
ccctacccctccacgcaggaccccgcctacgagcaggcgctgcgcacgtcgctggccacg
atcatggccgaccccggtgcccccgtacgcgaactgctcgacccggcgcgcgtgaaggaa
accctcggcaggccgctcggggggctctcgcccatgtacgaccgcatgggcatggaactc
gccgtcgggctcaacacctggctcaccgagcaggacatcagtctcgatctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system