KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_11260Help
Entry
PSJM300_11260     CDS       T02182                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2476420..2477019)
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQMLERDRSGGLRLAQALSRAMAEVGYCQQC
RTLSEEELCPQCADPRRDDSLLCIVQSPVDVFAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPELLARVAAGSFSEVILATNPTVEGEATAHYIAQLLIPKGLTLSRIAHGVPLGGELD
LVDGGTLAHALAGRKTISL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagtcccctcatccgccaactcatcgatgccctgcggattctccccggcgtc
gggcagaagacggcgcagcgcatggccctgcagatgctggaacgcgatcgcagtggtggt
ctgcgcctggcgcaggcactcagccgcgccatggcggaggtggggtattgccagcagtgc
cggacgctgagcgaagaggagctgtgcccgcagtgcgccgatccacgccgtgacgatagc
ctgctgtgcatcgtgcaaagcccggtggatgtcttcgcggtcgagcagaccggcttccgc
ggtcgctatttcgtgctcaaggggcatctgtcgcccctcgacggtctcggcccggaggcc
atcggtattccggaattgctggcgcgagtcgctgcaggttcgttcagcgaagtgatcctc
gccaccaacccgaccgtggaaggtgaagccaccgcccactacatcgcgcaactgctgatc
cccaagggcctgaccctcagccgtatcgcccatggcgtaccgctgggcggcgagctggat
ctcgtcgacggcggaaccctggctcatgcattggccgggcgcaagaccatcagtctctag

DBGET integrated database retrieval system