KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_11260Help
Entry
PSJM300_11260     CDS       T02182                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSJM300_11260 (recR)
DNA repair and recombination proteins [BR:psj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSJM300_11260 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2476420..2477019)
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQMLERDRSGGLRLAQALSRAMAEVGYCQQC
RTLSEEELCPQCADPRRDDSLLCIVQSPVDVFAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPELLARVAAGSFSEVILATNPTVEGEATAHYIAQLLIPKGLTLSRIAHGVPLGGELD
LVDGGTLAHALAGRKTISL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagtcccctcatccgccaactcatcgatgccctgcggattctccccggcgtc
gggcagaagacggcgcagcgcatggccctgcagatgctggaacgcgatcgcagtggtggt
ctgcgcctggcgcaggcactcagccgcgccatggcggaggtggggtattgccagcagtgc
cggacgctgagcgaagaggagctgtgcccgcagtgcgccgatccacgccgtgacgatagc
ctgctgtgcatcgtgcaaagcccggtggatgtcttcgcggtcgagcagaccggcttccgc
ggtcgctatttcgtgctcaaggggcatctgtcgcccctcgacggtctcggcccggaggcc
atcggtattccggaattgctggcgcgagtcgctgcaggttcgttcagcgaagtgatcctc
gccaccaacccgaccgtggaaggtgaagccaccgcccactacatcgcgcaactgctgatc
cccaagggcctgaccctcagccgtatcgcccatggcgtaccgctgggcggcgagctggat
ctcgtcgacggcggaaccctggctcatgcattggccgggcgcaagaccatcagtctctag

DBGET integrated database retrieval system