KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_11540Help
Entry
PSJM300_11540     CDS       T02182                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSJM300_11540
Enzymes [BR:psj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSJM300_11540
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSJM300_11540
Lipid biosynthesis proteins [BR:psj01004]
 Fatty acid synthase
  Component type
   PSJM300_11540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2534454..2535059)
Genome map
AA seq 201 aa AA seqDB search
MRMWLRGGVLAAMLWAQGALAGTALVVGDSISAAFGLETSQGWVHLLQQRLDDGEHDYRV
VNASISGDTSAGGLARLPALLSEHEPDIVIIELGGNDGLRGQPPAQLKRNLAAMAEQAQQ
AGAKVLLLGMRMPPNLGQRYTSAFADAFDSLAAEKDLPYVPFLLEGIGGVQGMMQADRVH
PTAQAQELMLDNVWPVLEPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgtggctgagaggtggtgtcctggcggcgatgctgtgggctcagggcgccctg
gccgggacggcgctggtggtgggcgatagtatcagtgccgctttcgggctggaaaccagc
cagggctgggtgcatctgctgcaacagcgcctggatgacggcgaacatgactatcgggtg
gtgaacgcgtcgatcagtggcgacacctcggccggcggcctcgcgcggctgcctgcgctg
cttagcgagcatgagccggatatcgtgatcatcgagcttggcggcaacgacggcctgcga
ggacagccgcctgcgcaattgaaacgaaatcttgcggcgatggccgagcaggcgcagcaa
gccggcgccaaggtattgctgctgggcatgcgcatgccgccgaacctgggacagcgctac
accagcgcctttgccgatgccttcgattcgctcgccgcagagaaggacctaccctatgtg
ccgttcctgctcgaggggatcggtggcgtgcagggcatgatgcaggccgatcgtgtccac
cccacggcgcaggcccaggaattgatgctggataacgtctggccggtgctcgaacccttg
ctttga

DBGET integrated database retrieval system