KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_11930Help
Entry
PSJM300_11930     CDS       T02182                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSJM300_11930
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSJM300_11930
Enzymes [BR:psj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSJM300_11930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2617460..2619055
Genome map
AA seq 531 aa AA seqDB search
MSAYQNDIKAVAALKEVAGSSWSAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDKAKAAEIQSQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEITEAELG
NGDVVIKREGKLLRPKRLPSNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPTAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQKDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFAEEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatcaaaacgacatcaaggccgttgccgctctgaaagaagtagctggaagc
agctggagcgctatcaaccctgagtccgtggctcgcatgcgcgctcagaaccgcttcaag
accggtctggaaatcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtttacacgcagtcgctgggttgctggcatggcttcatcggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgctacctctacctc
tccggctggatggtcgccgccctgcgttccgagttcggcccgctgccggaccagtcgatg
catgagaagactgccgtttccgacctgatcgaggagctgtacaccttcctgcgccaggcc
gacagccgcgagctggacctgctgttcaccgctctggacgctgcccgcgaagccggcgac
aaagccaaggccgccgagatccagtcgcagatcgacaactacgaaacccacatcgtcccg
atcatcgccgacatcgacgccggtttcggcaacccggaagccacctacctgctggccaag
cgcatgatcgaagccggcgcctgctgcatccagatcgagaaccaggtttccgatgagaag
cagtgcggccatcaggacggtaaagtgaccgttcctcacgccgacttcctcgccaagatc
gcggccgttcgctacgcgttcctcgagctgggtatcgacaacggcgtgatcgttgcccgt
accgactccctgggtgccggcctgaccaagcagatcgccgtgaccaaggagccgggcgac
ctgggtgacctgtacaactccttcctcgactgcgaagaaatcaccgaggccgagctgggc
aacggcgatgtcgtgatcaagcgtgaaggcaagctgctgcgtcccaagcgtctgccgtcc
aacctgttccagttccgcaaaggcaccggtgaagaccgttgcgtgctggactgcatcacc
agcctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaaggccatggtcgaccgcatccgtgaagtgattccgactgccaagcttgtctacaac
aacagtccgtccttcaactggaccctgaacttccgtcagcaggtattcgacgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gagaccgaactggcccaggtcgccgacgagaagatccgcaccttccagaaggacggttcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgctgcgctg
tcgaccgacaacctggccaaagggtacttcgcagaagaaggcatgctggcctacgtcaag
ggcgttcagcgtcaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggct
ggctccgacatcggcgacaaccacaaggagtacttcgctggcgaagcggctctgaaggca
agcggtaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system