KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_12150Help
Entry
PSJM300_12150     CDS       T02182                                 

Gene name
glk
Definition
(RefSeq) glucokinase (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSJM300_12150 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_12150 (glk)
   00052 Galactose metabolism
    PSJM300_12150 (glk)
   00500 Starch and sucrose metabolism
    PSJM300_12150 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSJM300_12150 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSJM300_12150 (glk)
   00524 Butirosin and neomycin biosynthesis
    PSJM300_12150 (glk)
Enzymes [BR:psj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSJM300_12150 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2671245..2672216)
Genome map
AA seq 323 aa AA seqDB search
MRTALVGDIGGTNARFALWRDQRLEAVRVLPTIDYARPEEAIRAYLADVGHGVQELQAVC
LACAGPVSGDIFSFTNNHWSLSRRAFCADLGLSDLLLINDFSAMALGMTRLRKGELIDIC
EGQPEPDRARLVIGPGTGLGVATLLPLKDGAWHALPGEGGHVCLPIGTPREAALWAILHR
KRGHVNAEAILSGGGLLELYRTSCELDGREPQLTTPAEVTAAALAGELYAAAVLEQFCTW
LGRIAGDNVLTTGARGGVYVVGGIVPRFAEFFIRSGFSRSLRDKGDMSRYFDDIPVWLVT
AQYPGLEGAGVALQQALEGTSAG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacggcactggttggggacatcggcggtaccaatgcgcgcttcgccctctggcgc
gaccagcgactcgaggccgtgcgtgtgttgccgaccatcgattacgcgcgaccggaagag
gcgattcgcgcctatctggcggatgtcgggcatggcgtgcaggagctgcaggccgtttgc
ctggcctgcgccgggccggtatcgggcgacattttcagtttcaccaacaaccattggagc
ctgagtcgccgggctttttgcgcggacctgggcctgagcgacctgctgctgatcaatgat
ttcagcgccatggccctgggcatgacgcgcttgcgcaaaggtgagttgatcgatatctgc
gaagggcaaccggagcccgaccgggcacgcttggtcatcggccccggcaccgggctgggt
gtcgccacgctgttgccgttgaaagacggcgcctggcacgcgttgccgggcgagggcggg
cacgtctgcctgcctatcggcacgccgcgcgaggctgcgctgtgggcaattctgcatcgc
aagcgagggcacgtgaatgccgaggcgattctcagtggcggtgggctgctggaactctat
cgcaccagttgcgagttggacgggcgggagccgcagctgaccacgccggccgaggtgacc
gcggcagcgctggccggcgagctctatgcggcggccgtattggaacagttctgcacctgg
ttgggtcggatagccggagacaacgtgctgaccaccggcgcgcgtggcggcgtgtatgtg
gtgggcggcatagtgccgcgcttcgcggaattcttcatacgtagcggtttcagccggagt
ctgcgcgacaagggcgacatgagccgctactttgacgacattccggtatggctggtgacc
gcccagtatccgggcctggaaggtgcgggcgtggctcttcaacaggcactggagggcacg
tcggccgggtga

DBGET integrated database retrieval system