KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13455Help
Entry
PSJM300_13455     CDS       T02182                                 

Definition
(GenBank) succinate dehydrogenase (D subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00020  Citrate cycle (TCA cycle)
psj00190  Oxidative phosphorylation
psj00650  Butanoate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13455
   00650 Butanoate metabolism
    PSJM300_13455
  Energy metabolism
   00190 Oxidative phosphorylation
    PSJM300_13455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFN78753
Position
2951180..2951548
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYFLFLIGYLVVNPGLEYAQWHQLYSATWMRIF
SLLALVALSVHAWVGMWTISTDYLTNMAIGKWATGVRFIFQAVCGIAMFTMFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacttttcgcgttcgggcctgtatgactggatggcccagcgc
gtttcggcagttgtcctcgctgcttatttcctgttcttgatcggatacctggtcgttaac
cccgggctcgaatacgctcagtggcatcagctgtactccgccacctggatgcgtatcttc
agtctcctggctctcgtcgcgctgagcgttcatgcgtgggttggtatgtggacgatttcc
accgactacctgaccaacatggcgatcggtaagtgggctaccggtgtgcggttcatcttc
caggcagtgtgtggcatcgccatgttcactatgttcgtctggggtgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system