KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13455Help
Entry
PSJM300_13455     CDS       T02182                                 

Definition
succinate dehydrogenase (D subunit)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSJM300_13455
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13455
   00650 Butanoate metabolism
    PSJM300_13455
  Energy metabolism
   00190 Oxidative phosphorylation
    PSJM300_13455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2951180..2951548
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYFLFLIGYLVVNPGLEYAQWHQLYSATWMRIF
SLLALVALSVHAWVGMWTISTDYLTNMAIGKWATGVRFIFQAVCGIAMFTMFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacttttcgcgttcgggcctgtatgactggatggcccagcgc
gtttcggcagttgtcctcgctgcttatttcctgttcttgatcggatacctggtcgttaac
cccgggctcgaatacgctcagtggcatcagctgtactccgccacctggatgcgtatcttc
agtctcctggctctcgtcgcgctgagcgttcatgcgtgggttggtatgtggacgatttcc
accgactacctgaccaacatggcgatcggtaagtgggctaccggtgtgcggttcatcttc
caggcagtgtgtggcatcgccatgttcactatgttcgtctggggtgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system