KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13475Help
Entry
PSJM300_13475     CDS       T02182                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSJM300_13475
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13475
  Amino acid metabolism
   00310 Lysine degradation
    PSJM300_13475
Enzymes [BR:psj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSJM300_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2957225..2958442
Genome map
AA seq 405 aa AA seqDB search
MAIEIKAPQFPESVADGTVATWHKQPGEAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGATASAAPAPAAAPATAPAAAPAAASAEEAILAPAARKLAEE
NGIDPNSVKGTGKDGRVTKEDVVAAIEAKKSAPAAAKPAASAAAAPVVAAGDRTEKRVPM
TRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKELFEKTHNGVRLGFMSFFVK
ASVEALKRFPAVNASIDGSDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMSLAEVESGIA
TFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAING
QVVIRPMMYLALSYDHRLIDGKEAVSFLVTIKNLLEDPARLLLDI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccccaattcccggaatcggtcgctgacggcaccgttgcc
acctggcacaagcaaccgggcgaagcagtcaagcgtgacgaattgatcgtcgatatcgag
accgacaaggtcgtgatggaagtactcgccgaagccgatggcgtgctgaccgaaatcgtc
aagaacgaaggcgacaccgtgctcagcggcgagttgctcggcaagctggaagcgggtgcc
accgcttcggcagcgccagcgcccgcagcggcacctgccaccgctccggctgccgctccc
gccgctgccagcgccgaagaggcgatcctcgcgccagccgctcgcaagctcgccgaagag
aatggcatcgaccccaacagcgtgaagggcaccggcaaggacggtcgcgtcaccaaggaa
gacgtggttgctgccatcgaggccaagaagtccgctccggccgcagccaagcctgctgcc
agcgctgccgctgcgcctgtcgttgcagccggtgaccgcaccgagaagcgtgtgccgatg
acccgtctgcgtgccaaggttgccgagcgtctggtcgaggcacagtcgaacatggcgatg
ctgaccaccttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtacaag
gagctgttcgagaagactcacaacggcgtacgcctgggtttcatgtccttcttcgtcaag
gcttccgtcgaggcgctgaaacgcttcccggcggtcaacgcctcgatcgacggcagcgac
atcgtctaccacggctatcaggacatcggcgttgccgtttccagcgaccgtggtctggtc
gtgcccgtgttgcgcaatgccgagctgatgagcctggcggaagtcgaaagcggcatcgcg
accttcggcaagaaggcccgcgacggtaaactgtcgatcgacgaaatgactggtggtacc
ttcaccatcaccaacggtggtactttcggttcgatgatgtccactcctatcgtcaatccg
ccgcaagccgccatcctgggcatgcacaacatcctgcaacgaccgatggccatcaatggt
caggtggtcatccggccgatgatgtacctggcgctgtcctacgatcatcgcctgatcgac
ggcaaggaagcggtcagcttcctggtgaccatcaagaacctgctggaagacccggcccgc
ctgctgctggacatctaa

DBGET integrated database retrieval system