KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13475Help
Entry
PSJM300_13475     CDS       T02182                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:psj01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:psj00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:psj00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2957225..2958442
Genome map
AA seq 405 aa AA seqDB search
MAIEIKAPQFPESVADGTVATWHKQPGEAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGATASAAPAPAAAPATAPAAAPAAASAEEAILAPAARKLAEE
NGIDPNSVKGTGKDGRVTKEDVVAAIEAKKSAPAAAKPAASAAAAPVVAAGDRTEKRVPM
TRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKELFEKTHNGVRLGFMSFFVK
ASVEALKRFPAVNASIDGSDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMSLAEVESGIA
TFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAING
QVVIRPMMYLALSYDHRLIDGKEAVSFLVTIKNLLEDPARLLLDI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccccaattcccggaatcggtcgctgacggcaccgttgcc
acctggcacaagcaaccgggcgaagcagtcaagcgtgacgaattgatcgtcgatatcgag
accgacaaggtcgtgatggaagtactcgccgaagccgatggcgtgctgaccgaaatcgtc
aagaacgaaggcgacaccgtgctcagcggcgagttgctcggcaagctggaagcgggtgcc
accgcttcggcagcgccagcgcccgcagcggcacctgccaccgctccggctgccgctccc
gccgctgccagcgccgaagaggcgatcctcgcgccagccgctcgcaagctcgccgaagag
aatggcatcgaccccaacagcgtgaagggcaccggcaaggacggtcgcgtcaccaaggaa
gacgtggttgctgccatcgaggccaagaagtccgctccggccgcagccaagcctgctgcc
agcgctgccgctgcgcctgtcgttgcagccggtgaccgcaccgagaagcgtgtgccgatg
acccgtctgcgtgccaaggttgccgagcgtctggtcgaggcacagtcgaacatggcgatg
ctgaccaccttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtacaag
gagctgttcgagaagactcacaacggcgtacgcctgggtttcatgtccttcttcgtcaag
gcttccgtcgaggcgctgaaacgcttcccggcggtcaacgcctcgatcgacggcagcgac
atcgtctaccacggctatcaggacatcggcgttgccgtttccagcgaccgtggtctggtc
gtgcccgtgttgcgcaatgccgagctgatgagcctggcggaagtcgaaagcggcatcgcg
accttcggcaagaaggcccgcgacggtaaactgtcgatcgacgaaatgactggtggtacc
ttcaccatcaccaacggtggtactttcggttcgatgatgtccactcctatcgtcaatccg
ccgcaagccgccatcctgggcatgcacaacatcctgcaacgaccgatggccatcaatggt
caggtggtcatccggccgatgatgtacctggcgctgtcctacgatcatcgcctgatcgac
ggcaaggaagcggtcagcttcctggtgaccatcaagaacctgctggaagacccggcccgc
ctgctgctggacatctaa

DBGET integrated database retrieval system