KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13485Help
Entry
PSJM300_13485     CDS       T02182                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00020  Citrate cycle (TCA cycle)
psj00640  Propanoate metabolism
psj00660  C5-Branched dibasic acid metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
Module
psj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSJM300_13485 (sucC)
   00640 Propanoate metabolism
    PSJM300_13485 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSJM300_13485 (sucC)
Enzymes [BR:psj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSJM300_13485 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFN78759
Position
2960147..2961313
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSAGYAVDNPREAAEACDKIGGTEWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLGERLVTYQTDANGQPVSKILVEACTDIAKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATVDPLVGAQPFQGRELAFQLGLKGDQVKQFVHI
FVGLAKLFVDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAARWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATEERVAE
AFKIILSDPNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNADLGAKM
LSDSGLNIIGANSLTDAAVQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcaactatttgccgagtacggactgccggtttcg
gcaggctacgcggtagacaatccacgagaagccgccgaggcttgcgacaagattggcggc
accgaatgggtggtcaaggctcaggtgcatgccggcggtcgcggcaaggccggcggcgtc
aagctggtgcgcagcaaggacgaggcccgagcgttcgcacagcagtggctcggcgagcga
ctggtgacctaccagactgatgccaatggccagccggtcagcaagattctggtcgaagcc
tgcactgatattgccaaggagctttacctgggcgcggtggtcgatcgcgcctcgcgtcgt
atcgtgttcatggcctccaccgaaggtggcgtggatatcgagaaagtcgcccacgacaca
cctgaaaagattctcaaggccaccgtcgacccgctggtcggcgcgcagccgttccaaggc
cgcgagctggctttccagctggggctcaagggtgaccaggtcaagcagttcgtgcacatc
ttcgtcggcctggccaagctgttcgtcgactacgacctagctctgctggaagtcaatccg
ctggtgatcaagaaggacggcaacctgcattgcctggatgccaagatcaacatcgacagc
aacgccatctatcgccagcccaagctgcgcgacatggccgacccgtcccaggacgatccg
cgtgaagcccatgcggcgcgttgggaactcaactacgtggccctcgatggcaacatcggt
tgcatggtcaacggcgctggcctggcgatgggcaccatggacatcgtcaacttgcacggc
ggcaagccggccaacttcctcgatgtcggcggcggtgccaccgaggagcgggtcgccgaa
gccttcaagatcatcctgtccgacccgaacgtggcggcggtgctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgattgccgaaggcatcatcggcgcggtgaaggaagtgggc
gtgaaggtgccggtcgtggtgcgcctggaaggtaacaacgccgacctgggcgccaagatg
ctgagcgacagcgggctgaacatcatcggtgcgaacagcctgaccgatgcggcggtacag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system