KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_13700Help
Entry
PSJM300_13700     CDS       T02182                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSJM300_13700
Enzymes [BR:psj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PSJM300_13700
Exosome [BR:psj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSJM300_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3001333..3002844
Genome map
AA seq 503 aa AA seqDB search
MSDPNNKQFIVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQ
SAVFVEALAQAGITNEQVAAIGITNQRETTIVWDRITGRPIYNAIVWQSRQSTPVCDQLK
RDGMEEHIRQTTGLVIDPYFSGTKIKWILDHVEGSRERARRGELLFGTVDSWLIWKMTQG
KAHVTDYTNASRTLLYDIHKLDWDPVMLQALDIPREMLPQVRSSSEIYGHAYLGSGQSTG
IPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGGKAVQSRHGLLTTIACGPRG
EVQYALEGAIFNGGSTVQWLRDELKVINDSLDSEYFATKVPDSNGVYLVPAFTGLGAPYW
DPRARGALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDAGEQLRSLRVDGGAVTNN
FLMQFQADLLGTRVERPRMKETTALGAAYLAGLATGFWSSLEELRSKASIERVFEPACDD
DRREALYKGWKKAVSRTRDWAED
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccgaacaacaagcaattcatcgtcgccctcgaccagggcaccaccagttcc
cgtgccatcgtgctggaccgcaacgccaacgtggtcaccatcgcccagcgcgaattcgcg
cagatctacccgcagcccagttgggtcgagcatgaccccatggaaatctgggccactcag
agcgccgtgttcgtcgaggccctggcccaggccggcatcaccaacgagcaggtcgcggcc
atcggcatcaccaaccagcgcgagaccaccatcgtctgggacaggatcaccggtcgcccg
atctacaacgccatcgtctggcagagccgccagagcacgccggtctgcgatcagctcaag
cgtgacggcatggaagagcacatccgccagaccaccgggctggtgatcgacccctatttc
tccggcaccaagatcaagtggattctcgatcacgtcgagggcagccgcgagcgtgcacgg
cgcggcgagctgctgttcggcaccgtcgacagctggctgatctggaagatgacccagggc
aaggcccacgtcaccgactacaccaacgcctcgcgcaccctgctctacgacattcacaag
ctggactgggacccggtcatgctgcaagcgctggatatcccgcgcgagatgctgccgcag
gtgcgctcgtcgtcggaaatctacggccacgcctatctgggttcgggccagagcaccggc
attcccatcgcgggcatcgccggcgaccagcaggctgcgctgttcgggcagatgtgcgtc
gagccgggccaggccaagaacacctacggcaccggctgcttcctgctgatgaacaccggc
ggcaaggcggtgcagtcgcggcacggtctgctcaccaccatcgcctgcggccccagaggc
gaagtccagtatgcgctggaaggcgcgatcttcaacggcggttccaccgtgcagtggctg
cgcgacgagttgaaggtgatcaacgattcgctcgattccgaatacttcgccaccaaggtg
ccggacagcaatggcgtctacctggtgcccgccttcaccggcctcggtgcgccctattgg
gacccacgtgcgcgcggcgcgctgttcggcctgacccgtggcgtcaaggtcgaccacatc
atccgcgccgcgctggaatccatcgcctaccagacccgcgacgttctggatgccatgcag
caggacgccggcgagcagctgcgctcgctgcgggtggacggcggcgcggtgaccaacaac
ttcctcatgcagttccaggccgacctgctcggcacccgggtcgaacgcccgcgcatgaag
gaaaccaccgcgctgggcgccgcctacctggcgggtctggcgaccggcttctggagcagc
ctggaagagctgcgcagcaaggccagtatcgagcgtgtcttcgaacccgcctgcgacgac
gacagacgcgaagcactctacaagggctggaagaaagccgtcagccgaacccgcgactgg
gcggaggattga

DBGET integrated database retrieval system