KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15010Help
Entry
PSJM300_15010     CDS       T02182                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSJM300_15010
   00670 One carbon pool by folate
    PSJM300_15010
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PSJM300_15010
    1.5.1.-  
     PSJM300_15010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3274529..3275233
Genome map
AA seq 234 aa AA seqDB search
MKQPPILITGAGQRIGLHCAERLLDDGHPVIISYRRERDDIDRLRARGATALRAEFDDEA
GIMAFIGELGKHTDRLRAIVHNASQWRPDTPGQEAEAFRQLFHVHMLAPYLINLHCAELL
RHGGPADIIHIGDDVTRKGSRKHIAYAASKAGLDNLTLSFAASLAPQIKVNGIAPALIQF
NVDDDEAYRRAALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHLI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctccgatcctcatcaccggagccggccagcgaatcggcctgcattgcgcc
gaacgcctgctggacgatggacatccggtcatcatcagctatcgccgcgagcgcgatgat
atcgaccgcttgcgggcccggggcgcgacggcgctgcgggccgaattcgacgacgaagcc
ggcatcatggccttcatcggcgaactcgggaaacacaccgaccgcctgcgcgccatcgtc
cacaacgcctcgcaatggcggcccgatacgcccggccaggaagccgaggcgttccgacag
ctgttccatgtgcacatgctggcgccctacctgatcaacctgcattgcgccgaactgctg
cgccacggcggcccggcggacatcatccatatcggcgacgacgtcacccgcaagggcagc
cggaaacacatcgcctacgccgcgagcaaggccggcctggacaacctcacgctgtccttc
gcggccagcctggcgccgcagatcaaggtcaacggcatcgcccccgcgctgatccagttc
aatgtcgacgatgacgaagcctatcgccgtgcagcgctggccaagtcggcgctgggcatc
gagccgggcgccgaggtgatctaccagagcctgcgctatctgttggacaatccctacgtc
accggcaccacactgaccgtgaacggcggccgccacctgatctga

DBGET integrated database retrieval system