KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15240Help
Entry
PSJM300_15240     CDS       T02182                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSJM300_15240
Enzymes [BR:psj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSJM300_15240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3324935..3325420
Genome map
AA seq 161 aa AA seqDB search
MERVYIGLGSNLAEPQKQLRTALLALDNIPATQLVAVSSFYSSDPLGPADQPRYVNAVAA
LDTTLPPLQLLDALQAIELDQGRERKAERWGPRSLDLDILLFGDRLIDEPRLQVPHYHLH
ARAFVLYPLAELAPPDLLLADGRRLDALLAACPFEGLQRLD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtctacatcggccttggcagcaaccttgccgaaccgcagaaacagctgcgc
acggcgctgctggcgctggacaatattccagcaacgcagctggtagccgtctcctccttc
tattccagcgacccgctgggacccgcggaccagccgcgctatgtgaatgccgtcgcggca
ctggatacaaccctgccgccactgcagttgctcgacgccctgcaagccatcgaactggac
caaggccgcgagcgcaaggccgagcgctggggaccgcgtagcctggatctggacatcctg
ctgttcggcgaccggctgatcgacgaaccgcggctccaggtcccgcactaccacctgcac
gcacgcgccttcgtgctctatccgctggccgaactggccccgcctgacctgctgctggcc
gacggcaggcgactcgacgcgctgctggccgcctgtccgttcgaaggcctgcagcgcctg
gactga

DBGET integrated database retrieval system