KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15335Help
Entry
PSJM300_15335     CDS       T02182                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
psj00010  Glycolysis / Gluconeogenesis
psj00051  Fructose and mannose metabolism
psj00562  Inositol phosphate metabolism
psj01100  Metabolic pathways
psj01110  Biosynthesis of secondary metabolites
psj01120  Microbial metabolism in diverse environments
psj01130  Biosynthesis of antibiotics
psj01200  Carbon metabolism
psj01230  Biosynthesis of amino acids
Module
psj_M00002  Glycolysis, core module involving three-carbon compounds
psj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_15335 (tpiA)
   00051 Fructose and mannose metabolism
    PSJM300_15335 (tpiA)
   00562 Inositol phosphate metabolism
    PSJM300_15335 (tpiA)
Enzymes [BR:psj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSJM300_15335 (tpiA)
Exosome [BR:psj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSJM300_15335 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSJM300_15335 (tpiA)
  Exosomal proteins of melanoma cells
   PSJM300_15335 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN79129
Position
complement(3344511..3345266)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMNGTRASVAELIEALRQQELPAKVEMVVFPSCVHVSQVVSGLEGLPFSA
GAQDCAEQSGFGALTGETSATQLSDAGCEWVLVGHSERRSLLGESDEVVSRKFAAALSCG
LKPILCLGESLEERQAGQTLEVVGRQLAHVIAEVGIAAFEQAVVAYEPVWAIGSGLTATP
EQAQEVHAALRKQLAREDQRVADGVRLLYGGSVKADNAAELFGMADIDGGLIGGASLKAN
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaagatgaacggtacccgcgccagcgttgca
gagctcatcgaggcgctccgccaacaggagttgccggcgaaggtcgagatggtggtgttt
ccttcctgtgtgcatgtctcgcaggttgtgagtggtctggagggcctgcctttttcggct
ggcgctcaggattgcgcagaacagtccgggtttggtgcgctgacgggcgaaacctcggcg
actcagctgtctgatgcgggctgcgagtgggtgctggtcggccattcggagcggcgctcg
ctgttgggtgaaagcgacgaggtggtcagtcgcaagtttgcggcggcgcttagttgcggt
ttgaaaccgattttgtgtcttggcgagtcgctcgaggagcggcaggccggacagacgctc
gaggtggtgggtcggcagttggcgcatgtgatcgccgaggtcggcatcgcggcattcgag
caggcggttgtggcgtatgagccggtctgggccattggttccgggctgacggcaacgccg
gagcaggcccaggaagtacatgctgcccttcgaaagcagctggcgcgagaagatcagcgt
gtcgccgatggcgttcgccttctttatggcggcagcgtcaaggcggacaatgccgccgag
cttttcggaatggcggatattgatggggggctgattggtggtgcctctctgaaagcgaat
gaatttggtgcgatctgtcgcgccgcggggaactga

DBGET integrated database retrieval system