KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15335Help
Entry
PSJM300_15335     CDS       T02182                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSJM300_15335 (tpiA)
   01230 Biosynthesis of amino acids
    PSJM300_15335 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSJM300_15335 (tpiA)
   00051 Fructose and mannose metabolism
    PSJM300_15335 (tpiA)
   00562 Inositol phosphate metabolism
    PSJM300_15335 (tpiA)
Enzymes [BR:psj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSJM300_15335 (tpiA)
Exosome [BR:psj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSJM300_15335 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSJM300_15335 (tpiA)
  Exosomal proteins of melanoma cells
   PSJM300_15335 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3344511..3345266)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMNGTRASVAELIEALRQQELPAKVEMVVFPSCVHVSQVVSGLEGLPFSA
GAQDCAEQSGFGALTGETSATQLSDAGCEWVLVGHSERRSLLGESDEVVSRKFAAALSCG
LKPILCLGESLEERQAGQTLEVVGRQLAHVIAEVGIAAFEQAVVAYEPVWAIGSGLTATP
EQAQEVHAALRKQLAREDQRVADGVRLLYGGSVKADNAAELFGMADIDGGLIGGASLKAN
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaagatgaacggtacccgcgccagcgttgca
gagctcatcgaggcgctccgccaacaggagttgccggcgaaggtcgagatggtggtgttt
ccttcctgtgtgcatgtctcgcaggttgtgagtggtctggagggcctgcctttttcggct
ggcgctcaggattgcgcagaacagtccgggtttggtgcgctgacgggcgaaacctcggcg
actcagctgtctgatgcgggctgcgagtgggtgctggtcggccattcggagcggcgctcg
ctgttgggtgaaagcgacgaggtggtcagtcgcaagtttgcggcggcgcttagttgcggt
ttgaaaccgattttgtgtcttggcgagtcgctcgaggagcggcaggccggacagacgctc
gaggtggtgggtcggcagttggcgcatgtgatcgccgaggtcggcatcgcggcattcgag
caggcggttgtggcgtatgagccggtctgggccattggttccgggctgacggcaacgccg
gagcaggcccaggaagtacatgctgcccttcgaaagcagctggcgcgagaagatcagcgt
gtcgccgatggcgttcgccttctttatggcggcagcgtcaaggcggacaatgccgccgag
cttttcggaatggcggatattgatggggggctgattggtggtgcctctctgaaagcgaat
gaatttggtgcgatctgtcgcgccgcggggaactga

DBGET integrated database retrieval system