KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_15345Help
Entry
PSJM300_15345     CDS       T02182                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSJM300_15345
Enzymes [BR:psj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PSJM300_15345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3346676..3347527)
Genome map
AA seq 283 aa AA seqDB search
MTETLSSTRLPCGSRVLDLSRPQVMGILNVTPDSFSDGGQHASLDAALRHAAAMVAAGAT
LIDVGGESTRPGARAVSPLEELERVAPVVEAIAREFDVIISVDTSTPAVIRESARLGAGL
INDVRSLARDGALDAAADTGLPVCLMHMRGEPGDMQNDPRYENVTEAVFQFLSERMAACA
AAGISPERVVLDPGFGFAKTLAHNLSLFKHMERLHELGRPLLVGVSRKSMVGQALGREVD
ERLYGSLALAALAVAKGAHILRVHDVAETVDVVRMIAAVQAAE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccctttcctccacccggctaccttgcggtagccgggttcttgatttgtcc
cgtccgcaggtgatgggcattctcaatgtgacgccggattccttctccgatggcggccag
cacgccagcctggacgccgcgttgcgtcatgctgcggcgatggtcgcggccggggcgacg
ttgatcgacgttggcggcgagtccacccggcccggtgccagggctgtgtcgcccctggag
gagttggagcgggtagcgccggttgtcgaggcgattgctcgtgagttcgacgtcatcatt
tccgtggatacctcgacgccggccgtcattcgcgaatccgcgcgactgggcgcggggctg
atcaacgacgtgcgttcgctggcgcgtgatggtgcgctcgatgcggcggccgacaccggc
ctgccggtctgtctgatgcacatgcgtggcgagccgggtgacatgcagaatgatccacgc
tacgagaacgtgaccgaggcggtcttccagtttctttccgagcgtatggccgcctgcgcc
gcggccggcatctcgcccgagcgcgtggtgctggatcctggcttcggtttcgccaagacg
ctggcgcacaacctcagcctgttcaagcatatggagaggctgcatgagctcgggcggccg
ctgctggttggcgtttctcgcaagagcatggtcggtcaggcgttggggcgtgaagtcgac
gagcggctttatggcagtctcgcactggcggcgctggcggtggccaagggtgcgcatatc
ctgagagtgcacgatgtcgccgaaacggtcgacgtcgttcggatgatcgctgccgtacag
gcggcagaatag

DBGET integrated database retrieval system