KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_16220Help
Entry
PSJM300_16220     CDS       T02182                                 

Definition
two-component hybrid sensor and regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSJM300_16220
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSJM300_16220
Enzymes [BR:psj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     PSJM300_16220
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSJM300_16220
Two-component system [BR:psj02022]
 CheA family
  CheA-CheYBV
   PSJM300_16220
Bacterial motility proteins [BR:psj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSJM300_16220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3525365..3529543
Genome map
AA seq 1392 aa AA seqDB search
MPTNNGPEPSSPKNTHLARSTLDYPVVGIGASAGGLKALMTFFEHMPSDCGMAFVIILHL
SPRHESSADKILQNVTRMPVRQVTGPVPIERNHVYVIPPAMVLSMNDGYLRLQKPTRARG
PQVAIDLFFRALADVHHTHAIGIVLSGSGADGSVGLSRIKEQGGVTLAQSPEDAEHDSMP
LHAIETGMVDIVLPAAEMPQRLMELGGNLESLIARSHPMPQPGETEQAGTDQGRIENEHA
RSQSRPNELALREILELLRNRTGHDFQHYKQATVLRRIERRLQVNALHDMPAYARFLHAR
PEETAALLADMLIGVTNFFRDREAFEALERDVIPVLFEQKAEAEDKSLRIWAVACSSGEE
AYSLGMLFADQTQLSEPNSEVQLQLFATDIDDRALETARTGIYPEAIVTDVPPSRLRQHF
IKEPGHYRMRKELRERILFARHDILRDPPFSRLDLVSCRNLMIYLDRNIQVEVLRMFHFA
LNPGGYLFLGSSETADACSQLFEPVDKKNRIYRARNLGSGVRNRSAYPFQALVNTPSPKA
PLRQQPNGDRKRSFAEMHQRALEQYAPPSVIIDRKSEIVHMSDRAGNFLRYVGGEPSLNL
ITLVHPQLRSDLRTALCQASHTGKSVEARRVKLERDDRHCYVNMVVRPFQDNEAGDEYML
VIFDEVEDCMDGSTLENTDLKDSVLLQLEAELQRTKEQLQVTMEHSETASDELRASNEEL
QAINEELRSATEEQETSKEELQSINEELTTVNFELKTKVDETSKINDDLQNLISSTDIAT
LFVDREMRIKWFTPRARDIFNVIGADAGRSLLDITHRLDYPQLYQDATQAFEALHLVERE
ICNRDGDHWYLARFLPYRTLDDRIQGAVLTFIDITDRRLAEEQLRAGEDHLRLLAQSTKG
YALITMDCDGLITSWNRGAAYIFGYREEEVIGRNIGIIYTEEDRLAGIPEAERKRALEQG
QATDERWHMRRDGTRCFFSGLVNPLVNNDGEITGFAKIARDVTDDRQRSNSQQNELEIIQ
AANQQKDEFFAVLSHELKHPLNLIQLNTDLIARSQAAKNTPNLLKATQAIQSAVRSQSRI
IDDLMDVSRIRTGKLKLNFNTLQYQNVLGSIEAVFSPLAQAEGVTFESFRPEQPVFVRAD
LTRLEQIIWNLLNNAWKFTKAGDRICMELERDGDQARLNVIDTGEGIAAAFLPKVFDMFG
QAEMQHAQRSKHGLGIGLALVKQLVEAHGGRIEAFSEGLGRGARFSVWLPIHLQTELALN
DQGNANELGALVGIDILLVDDSAEILATLCELLESEGANVTTADGGARGIELAEQSRFDV
ILSDIGMPDVDGHRMMSEIRRGTTNADTPSIALTGYGTLRDVEKARAAGFNLHLRKPIDL
QALIDAVTQAVH
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaataacggcccagagccctccagcccgaagaacacccacctggcccgaagc
acgctggactatcccgtggtgggcatcggcgcctcggcgggcggcctgaaggcgctgatg
accttcttcgagcacatgcccagcgactgcggcatggcgttcgtgatcatcctgcacctg
tcgccccggcacgagagcagcgccgacaagatcctccagaacgtcacgcggatgcccgtg
cggcaggtcaccgggccggtgcccatcgagcgcaatcatgtctacgtgattccgccggcg
atggtcctgtcgatgaacgacggttacctgcgcctgcagaaacccacccgcgcacgcgga
ccgcaggtggcaatcgacctgttcttccgcgccctggccgacgtgcaccacacccatgcc
atcggcatcgtgctgtccggcagtggggcggatggttcggtcggcctgtcgcgtatcaag
gaacagggcggcgtgaccctggcgcagagcccggaggatgccgagcacgactcgatgccc
ctgcacgccatcgaaaccggcatggtcgacatcgtgctgccggcggcggaaatgccccag
cgcctgatggaactcggcggtaaccttgaatcactcatcgcccgcagccacccgatgccg
cagcctggcgaaaccgagcaggccggcacggaccagggccggatcgaaaacgagcatgcg
cgcagccagtcccgccccaacgaactggcgttacgcgagattctcgaactgctgcgcaat
cggaccggtcatgatttccaacattacaagcaagccacggtgttgcggcgcatcgaacgc
cgcctgcaggtcaacgcgctgcacgacatgcccgcctatgccaggttcctgcacgctcga
cccgaagaaaccgccgcgctgctggcggacatgctgatcggcgtgaccaacttcttccgc
gaccgggaagccttcgaagcgctggagcgcgacgtcatcccggtgctgttcgagcagaag
gccgaggccgaggacaagtccctgcggatctgggccgtcgcctgttcgagcggtgaggaa
gcctactcgctgggcatgctcttcgccgaccagacgcagctgagcgagcccaacagcgaa
gtccagctgcagctgttcgccaccgacatcgacgatcgcgccctggaaaccgcacgcacc
ggcatctaccccgaagccatcgtgaccgatgtgccgcccagccgcctgcgccagcatttc
atcaaggagccggggcactaccgcatgcgcaaggagctgcgcgagcgcatcctcttcgcc
cgccacgacatccttcgagacccgcccttctcccggctcgacctggtctcctgccgcaac
ctgatgatctacctggaccggaacatccaggtcgaagtgctgcgcatgttccacttcgcg
ctcaaccccggcggctacctgttcctcggcagctcggagaccgccgacgcctgcagccag
ctgttcgagccggtggacaagaagaaccgcatctaccgcgccaggaacctgggctcgggg
gttcgcaacagatccgcctaccctttccaggcactggtcaacaccccttctcccaaggcg
ccactcagacagcagcctaacggcgaccgcaagcgctcgttcgccgagatgcaccagcgc
gccctcgaacagtacgccccgcccagcgtgatcatcgatcgcaagtcggaaatcgtgcac
atgtccgaccgcgccgggaatttcctgcgctacgtcggcggcgagccctcgctgaacctg
atcaccctggtccatccgcagctgcgctcggatttgcgcaccgcactatgccaggccagc
cacaccggcaagagcgtcgaggcgcggcgggtgaagctggaacgcgacgaccggcactgc
tacgtgaacatggtggtgcggcccttccaggacaacgaagccggcgacgagtacatgctg
gtgatcttcgatgaagtcgaagattgcatggacggcagcacgctggaaaataccgacctc
aaggacagcgtgctgctccagctggaagccgaactgcagcggaccaaggaacagctgcag
gtgaccatggagcactcggaaaccgccagcgacgaactgcgcgcctcgaacgaggaactg
caggcgatcaacgaagagttgcgttcggccaccgaggaacaggaaaccagcaaggaagag
ctgcaatcgatcaacgaagagctcaccacggtcaacttcgaactcaagaccaaggttgac
gaaaccagcaagatcaacgacgacctgcagaacctgatctcctcgacggacatcgccacc
ctgttcgtcgaccgcgagatgcgtatcaaatggttcacgccccgagcgcgggacatcttc
aacgtgatcggcgccgacgccggtcgctccctgctggacatcacccaccgcctcgattat
ccgcagctctaccaggacgctacgcaagccttcgaagcgctgcatctggtcgagcgcgaa
atctgcaatcgcgacggcgaccactggtacctggcgcgcttcctgccctaccgcacgctg
gatgaccgcatccagggcgccgtgctgaccttcatcgacatcaccgaccgccgcctggcc
gaagaacagctgcgcgccggcgaggaccacctgcggctgctggcacagagcaccaagggc
tatgcgctgatcaccatggattgcgacgggctcatcaccagttggaatcgcggcgccgcc
tatatcttcggctatcgcgaagaagaggtgatcggccgcaacatcggaatcatctacacc
gaagaggaccgcctggccggcataccggaagccgagcgcaaacgcgccctggaacagggg
caggccaccgacgagcgctggcacatgcgccgggacggcacgcgctgtttcttcagcggt
ctggtcaatccactggtgaacaacgacggcgaaatcaccggctttgccaagatcgcccgc
gacgtcaccgatgatcgacagcgcagcaacagccagcagaacgaactggaaatcatccag
gcggccaaccagcagaaggacgagttcttcgccgtgctctcccacgagctcaagcacccg
ctcaacctcatccagctcaataccgacctgatcgcgcgctcccaggccgccaagaacacg
ccgaacctgctcaaagcgacgcaggcgatccagagcgcggtgcgcagccagtcacggatc
atcgacgacctgatggacgtctcgcgcatccgcaccggcaagctgaagctcaacttcaac
acgctgcaataccagaatgtgctcggcagcatcgaggcggtgttcagcccgctggcccag
gccgagggcgtcacctttgaaagcttcaggccggagcagccggtgttcgttcgcgccgac
ctgacgcggctggagcagatcatctggaacctgctgaacaatgcctggaaattcaccaag
gccggcgatcgcatctgcatggaactcgagcgcgacggcgatcaggcgcgactgaacgtg
atcgacaccggcgaaggcatagccgccgccttcctgcccaaggtattcgacatgttcggc
caggccgagatgcagcacgcccagcgctccaagcacggcctgggcatcggcctggcgctg
gtcaagcaactggtcgaggcgcacggcggccgtatcgaggccttctccgaagggctcggc
cgcggcgcgcggttcagcgtctggctgccgatacacctgcagaccgagctggcgctcaac
gaccagggcaacgccaacgaattgggcgcgttggtcggcatcgacatcctgctggtggac
gactcggcggaaatcctcgccaccctctgcgagctgctggaaagcgaaggcgcgaacgtg
accaccgcagacggcggcgcccgaggcatcgaactggccgagcagtcgcgcttcgacgtg
atcctctccgacatcggcatgccggacgtcgacggccacaggatgatgagcgagatacgc
cgcggcaccaccaacgccgatacccccagcatcgccctgaccggctacggcaccctgcgc
gacgtggaaaaggccagggcggcaggcttcaacctgcatctgcgcaagccgatcgacctg
caggcactgatcgacgccgtgacccaggccgtgcattga

DBGET integrated database retrieval system