KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_16550Help
Entry
PSJM300_16550     CDS       T02182                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psj  Pseudomonas stutzeri DSM 10701
Brite
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSJM300_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3605230..3606261
Genome map
AA seq 343 aa AA seqDB search
MSAPLPILLGGLLLLAGTAHADELRNRASAIFQPIPEQVTEVRGKTINRDQAVLGHKLWF
DPRLSRSHIISCNTCHNLSIGGSDNVTTSIGHGWQKGPRNSPTVLNAVFNSAQFWDGRAK
DLQEQAKGPVQASVEMNNTPDRVEATLKSIPEYVAEFKKAFPKDKDPVTFDNMAYALEAF
EVSLTTPNSPFDRFLKGDDKALDAQQKEGLALFMDAGCIACHNGVNVGGQGYFPFGVIKK
PGADILPEGDKGRFAVTNTAADEYVFRAAPLRNIALTPPYFHSGEVWDLEEAVAIMGDSQ
LGRQLKDNEVKAITAFLHSLTGDQPQVAYPVLPASTATTPKPE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccactcccgatcctgcttggcggtctgttactgctcgccggcactgcccac
gccgatgagctgcgcaatcgcgccagcgccattttccaacccattcccgaacaggtcacc
gaagttcgcggcaagaccatcaaccgggaccaggcggtgctcggccataaactgtggttc
gatccgcgcctgtcacgcagccacatcatcagttgcaacacctgccacaacctgagcatc
ggcggcagtgacaacgtcaccacgtccatcggtcacggctggcagaaaggtcctcgcaac
tcgccgaccgtgctcaacgccgtgttcaactccgcgcaattctgggatggtcgtgccaag
gacctgcaggaacaggccaaggggccggtccaggccagcgtcgagatgaacaacacgccg
gaccgcgtggaagccacgctcaagagcattcccgagtacgtggccgagttcaagaaggcc
ttccccaaggacaaggatccggtcaccttcgacaacatggcctacgccctggaagccttc
gaagtcagcctgaccacgcccaactcgccattcgaccgcttcctcaagggtgacgacaag
gcgctggatgcccagcagaaggaaggcctggcgctgttcatggacgcgggttgcatcgcc
tgccacaacggcgtcaacgtcggcggccagggttactttcccttcggcgtgatcaagaag
ccgggtgcggacatcctgccggaaggcgacaagggccgcttcgcggtcaccaacaccgct
gccgacgagtacgtgttccgcgccgcaccgctgcgcaacatcgccctgaccccgccgtac
ttccacagcggtgaggtctgggacctggaagaggcagtggcgatcatgggcgacagccag
ctgggccgtcagctcaaggacaacgaggtcaaggccatcaccgcgttcctgcacagcctg
accggtgatcagccgcaggtcgcctatccggtgctgcccgccagcaccgcgacgacgccg
aagcccgagtaa

DBGET integrated database retrieval system