KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_18055Help
Entry
PSJM300_18055     CDS       T02182                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psj  Pseudomonas stutzeri DSM 10701
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3909277..3911127)
Genome map
AA seq 616 aa AA seqDB search
MSHTEAQRWKEKYLQALERQEQLEERWEARLDLLRRSLVRSSFAVEGGDPAVERCMQQLR
AVLREGDLDDGLSALVPRLESAVLNGERERHERVARLIGELQRLVEQLLALTPPNEVRKS
LKRYARQAEKRAAQASELPALLGELAGLQAQTLAVQDSSEKRADGLLQRLFGHGQRTLAE
QVAEAPVPQVAEPHAETTETVQVVCATTRRDDFDWSLLLDQLPMPAALFDEPEPAAPQEA
EEQPAADAAPDEGHYALPMMSEQAYSAIAEHVQATLFGLLDDLQLPESHGPQAAALRERV
ERGLNWYELVPVLDDLAVLMRAATSESQREFENYLQSLNERLSTMQDNLSAAHEGVAQSQ
EAARVLDDELRQHVGGLRHSVLEANDLASLKQAVRTRLDGLLATADAYQQRHSQHESQLG
ERLQQLVGRVTSLEQAASGLRQRLEEQRQLALVDTLTELPNRAAWDERLEVEVARWQRYG
GELLLAVLDVDHFKCINDDFGHLAGDRVLKIIAGELRKRLRKTDFIARFGGEEFALLLPH
TPLPEGLRLLDTLRQGIEQCPFHFKGEPVTVTLSGGLGRFAEGETLEQVFERADHALYAA
KDAGRNRIELGLTERL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgagccatacggaagcccagcgctggaaggaaaagtacctgcaggcgctggaacggcag
gagcagctcgaggagcgctgggaggcacgcctggacctgttgcgccgcagcctggtgcgc
agcagtttcgccgtcgagggcggcgatccagcggtcgagcgctgcatgcagcaactgcgt
gcggtactgcgcgagggcgatctcgacgatggcttgagtgccctggtgccgcgcctggaa
agcgccgtgctgaatggagagcgtgagcgccacgagcgtgtcgcccgactgatcggcgag
ctgcagcgcctggttgaacaactgctcgccctgacgccgcccaacgaggtgcgcaaatca
ctgaagcgttatgccaggcaggctgaaaagcgcgccgcccaggcgagcgagctgccggcg
ttgctcggtgagctggccgggctgcaggcgcagacgctggccgttcaggattcgtccgag
aaacgtgcggatggcctgttgcagcgcctgttcggccatggtcagcgaacgctggccgag
caggtggccgaggcgcctgtcccgcaggtggcggagccgcatgcggaaacgaccgaaacg
gttcaggtcgtttgcgccacaacgaggcgagacgatttcgactggtcgctgctgctcgac
cagttgccgatgcctgcggccctgttcgatgagcccgaaccggccgcgccgcaggaagcc
gaggagcagccggctgcagacgcggcgcccgacgaaggccattatgcgctgccgatgatg
tccgaacaggcgtacagcgcgatcgccgagcatgtccaggccaccctgttcggcctgctc
gacgatctgcaactgcccgaatcgcatgggccgcaggcggctgcgcttcgtgaaagggtc
gagcgggggctcaactggtacgagctggtcccggtactcgatgacctggccgtgctgatg
cgtgccgccaccagcgagagccagcgcgagttcgagaactacctgcagtcgctcaatgag
cgcctgtcgacgatgcaggacaatctgtccgccgcccatgagggcgtcgcgcagagccag
gaagcggcccgggtgctcgacgacgagctgcgccaacatgtcggcgggctgcgccatagc
gtgctcgaggccaatgacctggcgagcctgaaacaggcggtgcgcacgcgcctggatggg
ctgctggcaaccgccgacgcctaccagcagcgacacagccagcatgaaagccagctgggt
gagcgcctgcaacagctcgtggggcgcgtgacgagcctcgagcaggcggccagcggcctg
cgtcagcgcctcgaagagcagcgccagctggccctggtcgatacgctgaccgagctgccg
aaccgcgccgcctgggacgagcgtctggaagtcgaagtggcgcgctggcagcgctacggc
ggcgaactgctgctggccgtgctggatgtcgatcatttcaagtgcatcaacgacgacttc
ggccacctcgccggtgatcgggtgctgaagatcatcgccggtgagttgcgcaaacgattg
cgcaagaccgatttcatcgcccgcttcggcggcgaggagttcgcattgctgctgcctcat
acgcccttgccggaaggcctgcggttgctggatacgctgcgccagggcatcgagcagtgc
ccgttccatttcaagggcgagcccgtcacggtgacgctttcgggcggtctgggccggttc
gccgagggcgaaacgctggaacaggtcttcgagcgtgccgatcacgcgctctatgcggcc
aaggacgccggtcgcaatcgtatcgagctcggcctgaccgagcggttataa

DBGET integrated database retrieval system