KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_18765Help
Entry
PSJM300_18765     CDS       T02182                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSJM300_18765
Enzymes [BR:psj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSJM300_18765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4066482..4068551)
Genome map
AA seq 689 aa AA seqDB search
MSEQLSLLDQAPAPMPELQNAASLLALLDAWVEHGWLRALDRALAGFCLELNGESSPLLL
LSAALVSHQLGHGHVCLDLAATLASPDFALSLPPEGDEGSRARLPSELLASVELADWRAA
LAGSALVASGSDDGIEAPLVLHGGRLYLRRYWNYERAVATAIGMRLDDTQTVPVDLPQAL
QRLFPEPPVIDGQRQIDWQKLACALAARGSFSLITGGPGTGKTTTVVRLLALLQEPALAA
GQPLRIRLAAPTGKAAARLTESIGGQVASLPVGEAVKAEIPSEVTTLHRLLGSRPDSRHF
RHHAGNPLALDVLVVDEASMIDLEMMACLLDALPRHARLILLGDKDQLASVEAGGLLGDL
CRDAEGGFYDSQTRAWLEEVGGECLAEAGLQPGDGRQPLAQRTVMLRHSRRFGSASGIGR
LARAVNARAATQAREVFGDGFADLNLLRLRGEQDGALERLLLDGFGEARGYAHYLQKLHA
TRPDANCSVEDPAWQTWAAGVLEAFDGFQLLCAVRRGPWGVEGLNPRIAGMLQRRGLLEA
DSGWYEGRPVLVVRNDYSLGLMNGDIGIALRLPEPAEAPGAAPNQVLRVAFPRNDGSGAL
RFILPSRLNAVETVFAMTVHKSQGSEFAHTALILPDTLNPVLTKELLYTGITRARHWFSL
IETRPGIFDEAVQRQVARRSGLMDGLGKG
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacaattgtccctgctggaccaggcgcccgcgccgatgcccgagctgcagaac
gccgcgagtctcctggcgctgctcgacgcctgggtcgaacatggctggctgcgtgcgctg
gaccgcgccctggccggcttctgcctcgaactgaatggcgagagctcgccgctgctgctg
ctctccgcggcgctggtcagccatcagctgggtcatggccatgtctgcctggacctggcc
gccaccctggccagcccggattttgccctgtcgctgccacccgagggcgacgaaggcagt
cgcgcacgcctgccgtcggaactgctcgccagcgtcgaactggccgactggcgtgcggca
ttggccggtagcgcgctggtggcgagcggcagcgatgacggcatcgaggcgccgctggtg
ctgcacggcgggcgcctctacctgcgccgctactggaactacgagcgcgccgtggccacg
gccatcggcatgcgcctcgacgatacccagaccgtgccggtcgacctgccccaggcgctg
caacggctgttccccgagccaccggtgatcgacggccagcgccagatcgactggcagaaa
ctcgcctgcgccctggccgcccggggcagcttcagcctgatcaccggcggccccggcacc
ggcaagaccaccaccgtggtacgcctgctggcgctgctacaggaaccggcgctggcggcc
gggcagccgctgcgtattcgtctagcggcgcccactggcaaggcggcggcgcggctgacc
gaatccatcggtggccaggttgcctcgttgccggtgggcgaggcggtaaaagcggaaatc
cccagcgaagtcaccaccctgcaccgtcttttgggcagccgcccggacagccgccacttc
cgccaccacgccggcaacccgctggcgctggacgtgctggtggtggacgaagcctcgatg
atcgacctggaaatgatggcctgcctgctcgacgccctgccgcgtcatgcccggctgatc
ctgctcggcgacaaggaccagctcgcctcggtggaagccggcggcctgctcggcgacctg
tgccgcgatgccgaaggcggtttctacgattcgcagacccgcgcctggctcgaagaggtg
ggcggcgaatgcctcgccgaggccggcctgcaacccggcgacggccgccagcccctggcc
cagcgcaccgtgatgctgcgccactcgcggcggttcggcagcgcctcgggcatcggtcgc
ctggcccgcgcggtcaacgcccgtgccgcaacccaggcgcgcgaagtgttcggcgacggc
ttcgccgacctcaacctgctgcgcctgcgtggcgagcaggacggcgcgctggagcgattg
ctgctggacggcttcggtgaagcccgcggctacgcccattacctgcaaaagctgcacgcc
acccgccccgatgcgaactgctcggtcgaggaccccgcctggcaaacctgggccgccggc
gtgctcgaggcgttcgacggcttccagctgctctgcgccgtgcgcagaggcccctggggc
gtggaagggctcaacccgcgtattgccgggatgctccagcggcgcggtctgctggaagcc
gactccggctggtacgaaggccgcccggtgttggtggtgcgcaacgactacagcctgggc
ctgatgaatggcgacatcggcattgccctgcgcctgcccgaacccgccgaagcgcccggc
gccgcgcccaaccaggtgctgcgcgtggccttcccgcgcaacgacggctccggcgcgctg
cgctttatcctgcccagccgcctcaacgccgtggaaacggtgttcgccatgaccgtacac
aaatcccagggctcggaattcgcccacaccgcgctgatcctgcccgacaccctcaacccg
gtcctgaccaaggaactgctctacaccggcatcacccgcgcccgccactggttcagcctg
atcgaaacccgcccgggcatcttcgacgaagccgtgcagcggcaggtggcacgacggagt
gggttgatggatgggttggggaagggctga

DBGET integrated database retrieval system