KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_18990Help
Entry
PSJM300_18990     CDS       T02182                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSJM300_18990
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSJM300_18990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSJM300_18990
Enzymes [BR:psj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSJM300_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4120775..4121986
Genome map
AA seq 403 aa AA seqDB search
MTSYRNGPDARGLFGSFGGQYVAETLMPLIHELAAEYEKAKQDPEFAKELAYYQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKQRIIAETGAGM
HGVATATVAARFGMQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETRDQLQAQEGRLPDSLVACIGGG
SNAMGLFHPFLDDQSVKIIGVEAAGYGIETGKHAASLNGGVPGVLHGNRTFLLQDEDGQI
IDAHSISAGLDYPGIGPEHAWLHDIGRVEYTSITDQEALDAFHLCCRKEGIIPALESSHA
LAEVFKRAPTLPKDHLMVVNLSGRGDKDMQTVMHHFAEQEERI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacttcataccgcaacggccctgacgcccgcggcctgttcggctcgttcggcggccag
tacgtcgccgaaaccctgatgccgctgatccacgagctggccgccgaatacgagaaggcc
aagcaggaccccgagttcgccaaggaactcgcctactaccagcgcgactacgtcggtcgc
ccttccccgctgtatttcgccgaacgcctgaccgagcactgcggcggcgcgaagatctac
ctcaagcgcgaagagctgaaccacaccggcgcgcacaagatcaacaactgcatcggccag
attctcctggcgcggcgcatgggcaagcagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgctaccgtggccgcgcgcttcggcatgcagtgcgtgatctacatg
ggcaccaccgacatcgaccgccagcaggccaacgtcttccgcatgaagctcttgggcgcc
gaggtgatcccggtcaccgccggcaccggcacgctgaaagacgcgatgaacgaagccctg
cgcgactgggtgaccaacgtcgacagcaccttctacctgatcggcaccgtcgccggcccg
cacccctacccggccatggtccgcgacttccaggcggtgatcggcaaggaaacccgcgac
cagctgcaggcccaggaaggccgcttgcccgactcgctggtcgcctgcatcggcggcggt
tccaacgccatgggcctgttccaccccttcctcgatgaccagagcgtgaagatcatcggc
gtcgaagccgccggctacggcatcgagaccggcaagcatgccgccagcctcaacggcggc
gtacccggcgtgctgcacggcaaccgtaccttcctgctgcaggacgaggatggccagatc
atcgatgcccactcgatttccgccggcctcgactatcccggtatcggtcccgagcacgcc
tggctgcatgacatcggtcgtgtcgagtacacctcgatcaccgaccaggaggcgctggac
gccttccacctgtgctgccgcaaggaaggcatcatcccggcgctggagtcctcccacgcg
ctggccgaagtcttcaagcgcgcgcccacgctgcccaaggatcatctgatggtggtcaac
ctgtccggtcgtggcgacaaggacatgcagaccgtcatgcaccactttgccgaacaggaa
gaacgcatatga

DBGET integrated database retrieval system