KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_18995Help
Entry
PSJM300_18995     CDS       T02182                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psj  Pseudomonas stutzeri DSM 10701
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSJM300_18995 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSJM300_18995 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSJM300_18995 (trpA)
Enzymes [BR:psj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSJM300_18995 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4121983..4122792
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAELKEQNRAALVTFITAGDPDYASSLEILKGLPDAGADVIELGMPFTDPMAD
GPAIQLANIRALSNKQDLAKTLQMVREFRQGNQTTPIVLMGYFNPIHKMGVERFIAEAKE
AGVDGLIVVDLPPEHNEDLCDPAQAAGIDFIRLTTPTTDDARLPVVLNNSSGFVYYVSVA
GVTGAGSATLEHVEQAVARLKRHTGLPVAIGFGIRTPEQAAAIARLADGVVVGSALIDHI
AKAESSTEAVAGVLGHCRELAEGIRNARA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacgcgcttcgccgagctgaaagaacagaaccgcgccgcgctggtg
accttcatcaccgctggcgacccggactacgcctcctcgctggaaatcctcaagggcctg
ccggatgccggcgccgacgtgatcgagctgggcatgcccttcaccgaccccatggccgac
ggcccggcgatccagctggccaatatccgtgccctgagcaacaagcaggacctggcgaag
accctgcagatggttcgcgaattccgccagggcaaccagaccaccccgatcgtgctgatg
ggttacttcaaccccatccacaagatgggcgtcgagcgcttcatcgccgaggcgaaggaa
gctggcgtcgacgggctgatcgtcgtcgacctgccgccggagcataacgaagacctctgc
gacccggctcaggccgccggcatcgacttcatccgcctgaccaccccgaccaccgacgac
gcacgcctgccggtggtgctgaacaacagttcgggcttcgtctactacgtctcggtggcc
ggcgtgaccggtgccggttccgcgaccctggagcacgtcgagcaggccgtcgcgcgcctc
aagcgccacaccgggctgccggtggccatcggcttcggcatccgcaccccggaacaggcg
gcggccatcgcccggctggccgacggcgtggtggtcggctccgcgctgatcgaccatatc
gccaaggctgagagttccaccgaagccgtcgccggcgtgctcggccattgccgcgagctg
gccgaaggcatccgcaacgcccgcgcctga

DBGET integrated database retrieval system