KEGG   Pseudomonas sp. TKP: U771_05430Help
Entry
U771_05430        CDS       T02969                                 

Definition
glucan 1,4-alpha-maltohexaosidase
Organism
psk  Pseudomonas sp. TKP
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1196463..1198052)
Genome map
AA seq 529 aa AA seqDB search
MKCKLLYCTVLLSLLTNFATGAPSPLRNGGGEDIILQGFHWNSSRNTPEKWYQVLARMAP
VIGQDGFTKIWLPPVWVDKSSWSDPAKGTSGGGEGYYWNDFDKNSAYGTDAELKQAATAL
TRAGVQVMYDVVPNHMNDKIPGVMVRFPRGYKLWRNDCTPPSDCDEGDPFEDGAADLNTA
SPEVSPRFMQEFRNLRDNYSAHDLRFDYVRGYSPERVDLWMKNFNDQAFCVGEFWKSPGE
FPASDWRSKASWQDALKDWSDRSHCAVFDFALKERMQNGSIAEWRHGLNGNPVKSWREIA
VTFVDNHDTGYSPGQYGGQHHWPLPDPMINLAYAYILLAPGIPVVYWPAMYDWGRGNLIR
TLIALRKSAGIRADSPISFQTQYSGLVAATNGTQQRILMALDSDLNKVPDDFTPVMNADG
QRIRIWKTATTAQDVPLTLHCDNAQPGNRQAVYAVGSPLELSAWDPAHAIPLQPSTPNRW
SGIVTLPAQQAIEWKCVIRSLDNINQVDWQADPNNRASPGTQTESVGHF
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcaaacttctctactgcaccgttctcctgagcctgctgacgaacttcgctacc
ggggccccgtcgcccctgcgtaatggcggcggcgaagacatcatcctgcaaggctttcac
tggaactccagtcgcaacacacctgaaaagtggtaccaagtgcttgcccgaatggccccc
gttatcggccaggacggtttcaccaagatctggttaccgcccgtgtgggtggataagtcc
agctggagcgatccggccaaaggtacttcgggcggaggtgaaggctactactggaacgat
ttcgataaaaacagcgcgtacggcaccgacgctgaactcaagcaagctgccacggccctg
acgagagccggcgtgcaggttatgtatgacgtggtgccgaatcacatgaacgacaagatt
cccggcgtgatggtgcgcttcccccggggctacaaactgtggcgcaatgactgcacgccc
cccagcgattgcgatgaaggcgatccattcgaggacggtgcggcggacctcaataccgcc
agcccagaggtttcaccacgcttcatgcaggagtttcgcaacctgcgggacaattacagc
gcccacgacttgcgcttcgactatgtacgcggttactcacctgagcgggtcgacctgtgg
atgaaaaacttcaacgaccaggcgttctgtgtcggcgagttctggaagagccccggcgaa
ttccccgccagcgactggcgcagcaaggccagttggcaggacgcactcaaggattggtcg
gatcgctcgcactgcgccgtgttcgatttcgccctcaaggagcgcatgcaaaacggcagc
atcgccgaatggcgccacggcctcaacggcaaccccgtcaagtcttggcgcgaaatcgcc
gttacattcgtagacaatcacgataccggttattcgccggggcaatatggtggtcaacat
cattggcctttgcccgatccgatgattaacctcgcgtacgcctacatcctcctagccccc
ggaatacccgtcgtgtactggcccgccatgtatgactgggggcgtggcaacctgatccgc
acgctcatagccctgcgcaagagtgccggcatcagggccgactcaccgatcagtttccag
acccaatattccggcctggtggccgccaccaatggcactcaacagcggatactgatggcc
ttggactccgacttgaacaaagtccccgacgacttcacccccgttatgaatgccgacggg
caacgcatccgcatttggaaaaccgccacgacggcacaggatgtccccctcacgctgcat
tgcgacaacgctcagccagggaacaggcaagcggtctacgccgtcggttcaccgctggaa
ctgagcgcatgggaccctgctcatgcgatccccctgcaacccagcacccctaatcgatgg
agcggcatcgtaacgctaccggcgcagcaggccatcgagtggaaatgtgtgatccgcagc
ctcgacaacatcaatcaggttgactggcaagccgaccccaataaccgtgcctcgccaggc
actcaaaccgaaagcgtggggcacttttga

DBGET integrated database retrieval system