KEGG   Pseudomonas sp. TKP: U771_21330Help
Entry
U771_21330        CDS       T02969                                 

Definition
monoamine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
psk  Pseudomonas sp. TKP
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    U771_21330
   00330 Arginine and proline metabolism
    U771_21330
   00340 Histidine metabolism
    U771_21330
   00350 Tyrosine metabolism
    U771_21330
   00360 Phenylalanine metabolism
    U771_21330
   00380 Tryptophan metabolism
    U771_21330
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     U771_21330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4704118..4705701)
Genome map
AA seq 527 aa AA seqDB search
MGLTRREALSSIAAVGGEKAVKDALAVLGLGPSSHRRPQPLKLKDGLGQGTRVLVLGAGI
AGLVTALELTRAGFAVQVLEARDRVGGRTWTLRHGDRVDYKDGRTQTAAFEPGHYFNAGP
ARIPSQHRTILDYCSELGVPLEVLVNSSHGAQVRPDVNQPAFTVGQAINDARGHLSGLLA
KAVQRDALDDVLSAEERTRLLAFLQVYGDLSQELAFEGTIRSGHLESPAHPGALPASRRP
LALDQLLHPELWGALLHTEFPEFSATMFQPVGGMDRITDAFYQRVSDHVQLGAQVRQIRQ
LDDGVAVTYHDQRSGREQVVRADYLVSTLPLPLVARLDTDFSDPIKAALLSTRSDQATKV
AWQSPRFWETDYRTYGGLSWIEHPARLLWYPSNDLNTREGLLVAGYVTGEGADVFGAQPF
DQQYATSKEAVELLHPGYSRYLRHPLAVSWEQIPFSEGPWLQREHFPAAASALLEAGHGR
VYFAGDGLVQSGVGIWQESAANSARHVVAQLAERVTRQTHLAAVAAS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggactgacacgacgtgaagccttatccagcatcgctgcggtaggcggcgaaaaggcc
gtgaaggatgcactggcggtattgggcctggggccgtcgtcgcaccgccggccgcaaccg
ctgaaactcaaggacggcctggggcagggcacccgcgtgctggtgctcggtgctgggatt
gccgggctggtcaccgccttggaactgacccgcgccggcttcgccgtgcaggtgctggaa
gcccgcgaccgcgtaggcgggcgcacttggaccctgcgccatggcgaccgtgtggactac
aaggatggccgtacgcaaaccgccgcgttcgagccggggcattacttcaacgccgggcct
gcacggattcccagccagcaccgcacgatcctcgactattgcagtgagctgggggtgccg
ctggaagtactggtcaacagcagccatggcgcccaggtacggccggatgtgaaccagccg
gcgtttacggttggccaggcgatcaacgatgcgcgcgggcacttgtccgggttgctggcc
aaagcggtgcagcgcgatgcgcttgacgatgtgctgagcgccgaggaacgcacgcgcttg
ctggcattcctgcaggtgtatggcgacctgtcccaggagctggcctttgagggcacgatc
cgttcggggcacctggaatcccccgcccaccctggcgccttgcctgccagccgccgcccg
ttggcgctggaccaactgctgcaccccgagctgtggggcgccttgctgcacaccgagttc
ccggagttctcggcgaccatgttccagccggtgggcggcatggaccgcatcaccgatgcc
ttctaccagcgcgtcagcgatcacgtgcagttgggcgcccaggtccgccagatccgccag
ttggacgacggtgtcgcggtcacctatcacgaccagcgcagcggccgcgaacaggtggtg
cgcgccgattacctggtctcgacgctaccgctgccgctggtggccaggctcgacaccgac
ttcagcgacccgatcaaagccgcgctgctcagcacccgcagcgaccaggcgacgaaagtg
gcgtggcaatcgccgcgcttctgggaaaccgactaccgcacctacggcggcctgtcctgg
atcgaacacccggcgcgcctgctctggtaccccagcaacgacctcaacacccgtgagggc
ttgttggtggcgggctatgtgaccggggagggcgccgatgtgtttggcgcgcaaccgttc
gaccagcagtacgccacctccaaggaggctgtggagttgttgcatcctgggtattccagg
tacctgcgccacccactggcggtgtcctgggaacagatccctttcagcgaaggcccgtgg
ctgcagcgtgagcacttcccggccgctgccagcgccttgctcgaagcaggccacggccgc
gtgtacttcgccggcgacggcctggtgcaaagcggcgtgggcatctggcaggaatcggcg
gccaactcggcgcggcatgtggtggcgcaactggctgagcgcgttacccgacaaacccac
cttgcggcagtggccgcctcctga

DBGET integrated database retrieval system