KEGG   Pseudomonas sp. TKP: U771_21750Help
Entry
U771_21750        CDS       T02969                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psk  Pseudomonas sp. TKP
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    U771_21750
Enzymes [BR:psk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     U771_21750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4801561..4802478)
Genome map
AA seq 305 aa AA seqDB search
MPAKVVVVGSLNMDLVTRASRLPRAGETLIGQSFSTVPGGKGANQAVASARLGAEVAMIG
CVGTDAYGSQLRDALRVEGIDCGAVSTVAGSSGVALIVVDDSSQNAIVIVAGSNGELTPA
SLQASDAVLQAADVIVCQLEVPMETVGHALKRGRELGKTVILNPAPVSGPLPTEWYASID
YLIPNESEATALSGVTVDSLDSARLAATELIKAGAGKVIITLGAQGALFADGHGFEHLVA
PKVKALDTTAAGDTFVGGFAAALASGKSEAEAIRFGQVAAALSVTRDGAQPSIPTLHDVQ
GFVPS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtagtggtagtaggcagcttgaacatggacctggtgacccgtgccagt
cgcttgccccgtgccggtgaaaccttgatcggccaatcgttttccaccgttcccggcggc
aagggcgccaaccaggccgtggcttcggcgcggttgggggccgaggttgcgatgatcggt
tgtgtcggcactgatgcctacggcagccagctgcgcgatgcgctgcgggtggaaggcatc
gattgcggggctgtgagcaccgttgccggctccagcggcgtggcgctgattgtcgtagat
gacagcagccagaacgccattgtgatcgtcgcgggcagtaacggtgaactcacgccggct
tcgttgcaggcgtctgacgcggtgctgcaggccgccgatgtgatcgtctgccagcttgaa
gtgccaatggagactgtggggcatgcgctcaagcgcggtcgtgagctgggtaagacggtt
attcttaacccggcgccggtcagcggtcctttgccgaccgagtggtatgcctcgatcgac
tacctgattcccaatgaaagcgaggcgaccgcgctgagcggtgtgacggtcgactccctc
gacagcgccaggctggctgcgaccgaattgatcaaggcgggcgccggtaaagtcatcatt
acccttggtgcccagggcgcgttgttcgccgatggccatggctttgagcacctggtggcg
cccaaggtcaaggcgctggataccacggcggccggtgatacttttgtgggtggctttgcc
gcggcattggccagcggcaagagcgaagccgaggccattcgattcggccaagtggcggcg
gcgctgtcggtgacccgtgacggcgcccagccttccatccctacgctgcacgacgtacaa
ggttttgtgccctcatga

DBGET integrated database retrieval system