KEGG   Pirellula staleyi: Psta_0133Help
Entry
Psta_0133         CDS       T01147                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psl  Pirellula staleyi
Pathway
psl00900  Terpenoid backbone biosynthesis
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psta_0133
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Psta_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ADB14829
UniProt: D2R0G1
Position
complement(168691..169701)
Genome map
AA seq 336 aa AA seqDB search
MYVSAHQGWVTVEAPAKLNLFLEVLGKRPDGFHELETLMTSVSIFDTLRLRRSSDASISL
RCHWATGYLARETAATNAQAASSTTTANDLPSSPFGDLPPPEKNIVTKALVKLRELAGNE
QLGCEVHLTKRIASVAGLGGASSDAVAAILAANIAWNLHFSSAELAEVAAAVGSDTVFFL
AGGRAICRGRGERVTPVKRACQQFVVARPPVGLSTPRVFSKLKIPQNPLDIATYLGEKTS
GEKTSRDGRLHNRLEQPARELTPWIGELSSALDRAGVAQHQMTGSGSSYFGLARSARHAR
RIAAVLRARQMGLVYSATSATASGFSPLTTTETAQQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtctcagcacaccaggggtgggtgacagtcgaggctccggccaagctgaacctg
tttctcgaagtgctcggtaaacggcccgacggctttcacgaactcgaaacactgatgacc
agtgtctcgatcttcgacacactccgtttacgccggtcgagcgatgcatcgatttcgctc
cgttgccattgggctactggctacctcgcgcgcgaaacagcggcgaccaatgcccaagct
gcaagctccaccaccacggcgaacgatttgccgagttcacccttcggcgatctccccccg
cctgagaaaaacattgtcaccaaagcgcttgtgaaactgcgcgagcttgcgggcaacgaa
cagctcggctgcgaagtgcatctcaccaagcgaatcgcttcggtcgcgggactcggtggc
gcttcgagcgacgcggtcgctgcgatcctggccgccaacatcgcctggaacttgcatttc
tcctccgccgagctggccgaagtggctgcggcggtcggaagcgacacagtcttttttctc
gcgggtggtcgcgccatttgccgagggcgcggcgagcgcgtaaccccggtgaaacgtgcg
tgtcagcagtttgtcgtcgcgcggcctcccgtcggtctgtccaccccacgcgttttctcg
aagctgaagattccgcaaaatccgctggatatagcgacgtatttgggggagaaaacaagt
ggcgagaagacgtcgcgcgatgggcggctgcataaccgactcgagcaaccagcgcgcgag
ctgaccccctggatcggcgagctgagtagcgccttggatcgcgccggagtcgcgcagcat
caaatgaccgggagcggttcgagctactttggtttggcgcgatcggcgcgccacgcccgg
cgcatcgccgccgtgcttcgcgcacggcagatgggcttggtctactccgccacgagcgcc
acagcctccggattttcccctttgacaaccactgagacggcacagcaataa

DBGET integrated database retrieval system