KEGG   Pirellula staleyi: Psta_0336Help
Entry
Psta_0336         CDS       T01147                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psl  Pirellula staleyi
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psta_0336
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psta_0336
Enzymes [BR:psl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psta_0336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
435141..435929
Genome map
AA seq 262 aa AA seqDB search
MTNILEKIVAKKQEEIASRRSLIPVEVLEAAVAEAPPVRDFFAALAAPGPIKLIAEVKKA
SPSKGIIRENFDPVAIAREYEAAGATCLSILTDEPFFQGKLEYLAQIRQAVNIPLLRKDF
ILDTYQLLEARMAGADAVLLIAECLDDCNLRKLHNEAIELGLTPLVEFYDPENLDRVLAA
GATLIGVNNRDLRTFVTDLGHTIRMRDKVPLDAVFVGESGIYTRDDVLRLQEAGVDAMLV
GESLMRQPDITTAVKTLLGTLS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacatccttgaaaagattgtcgccaagaaacaagaagagatcgcctcgcgccgc
tcgctgattccggtggaagtgctcgaagcagcggtcgctgaagctccccccgtacgcgat
ttttttgcggccctcgccgccccgggaccgatcaagctgatcgcagaagtgaagaaggcg
agccccagcaaagggatcattcgcgagaacttcgatcccgttgccatcgcccgcgagtac
gaagctgctggtgccacttgcctcagcatcctgaccgacgaaccgttcttccaagggaag
ctcgagtacctggcgcaaatccgtcaggcagtcaacattccgctcctgcgcaaagacttc
atcctcgatacctaccagcttctcgaagcgcgcatggcgggtgccgatgcggtcctgctg
attgccgaatgtctcgacgactgcaatctccgcaagctgcacaatgaggcgattgaactc
ggtctcacgccgctggtcgagttctacgatcccgagaatctcgaccgcgtgcttgctgcc
ggcgcgacgctgattggcgtgaacaatcgcgacctccgcaccttcgtcaccgaccttggc
cacacgatccgaatgcgcgacaaagtccccctcgatgccgtgtttgtcggcgaaagtggc
atctatacgcgcgacgacgtgctacgtttacaagaggcgggggtcgatgccatgctcgtc
ggcgaaagtctcatgcgacaacccgacatcactaccgccgtgaagactttgctcggcacg
ctttcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system