KEGG   Pirellula staleyi: Psta_0617Help
Entry
Psta_0617         CDS       T01147                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
psl  Pirellula staleyi
Pathway
psl00260  Glycine, serine and threonine metabolism
psl00750  Vitamin B6 metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
psl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psta_0617
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psta_0617
Enzymes [BR:psl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psta_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADB15304
UniProt: D2R4F6
Position
complement(768801..770201)
Genome map
AA seq 466 aa AA seqDB search
MPLADFAFQKCISPTCDFVCGCEEVRVSCPTCGDLLDIGYDWSRSQVPKSLKYFEEMWSR
RYEPLRFSGIWRFHELIPFASPDLVVTVGEGQTLLQQTDSVGSYVGMKPGRLHLQYEGMN
PSGSFKDNGMSAAFTHARAIGARRAACASTGNTSASLAMYCAATKLMKAIIFIGSGKISY
GKLSQALDYGALTVQIAGDFDDAMARVQEVSRDLGICLVNSVNPFRLEGQKSVMFRVLEA
LRWEVPDWIVVPGGNLGNSSAFGKAFAELKSLGLVDRVPRLAVINAAGADTLYELFERRG
LRWNGGHANMEIAHHYYNELDQLGRKANTIASAIEINRPVNLRKCLRALEFMDGVVRQVS
DQEMLDAKAKIAAGGFGCEPASAASVAGARLLRDQGVISPDDRVVCILTGHQLKDPTATV
AYHTTDQDKFNEVLGSRGVKRASFANRAVAVPNDLGEIVKAIQLYS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgccacttgccgactttgcctttcagaaatgcatcagccccacttgcgatttcgtttgt
gggtgcgaagaagtgcgcgtcagctgccccacgtgcggcgatttgctcgacatcggctac
gactggagccggtcgcaagttcctaagagcctgaagtacttcgaagagatgtggtcccgc
cgctacgagcccctccggttcagtggcatttggcgtttccacgagctgattcccttcgct
tcgcccgacctggtggtgaccgtcggcgaaggacaaacccttttgcagcaaacagatagc
gtcggcagctacgtcggcatgaagcccggccggctccacctgcagtacgaagggatgaac
ccttccggaagcttcaaagacaacggcatgagtgcggcgtttacgcacgctcgtgcgatc
ggtgcccgccgagccgcctgtgcctcgaccggcaacaccagcgcctcgctcgccatgtac
tgtgccgccaccaaactgatgaaggcaatcatcttcatcggcagtggtaaaatcagctac
ggcaaattatcgcaagccttggactacggtgcacttacggtgcaaatcgccggcgacttc
gacgacgccatggcccgcgttcaagaggtttcgcgcgacctgggaatctgcctggtcaac
agcgtgaacccgttccgcctcgaaggccaaaagtcggtgatgttccgcgtgctcgaggcg
ctccgctgggaagttcccgactggatcgtcgtgccgggcggtaacctgggtaacagcagc
gcttttgggaaggcatttgccgagctcaagagcctcggactggtcgaccgtgtcccccgt
ttggccgtcatcaacgccgccggtgccgacacgctgtacgaactgttcgagcgtcgcggc
ctccgctggaacggcggacatgccaacatggagatcgcccaccactactacaacgaactc
gatcagctcgggcggaaggccaacaccatcgcctcggccatcgaaatcaatcgcccggtg
aacttgcgtaagtgcctgcgagcactcgagttcatggatggggtggtgcgtcaggtgagc
gatcaagagatgctcgacgcgaaagccaaaattgccgctggtggtttcggctgcgagcca
gcctcagccgcgagtgtggctggcgctcgactcctccgcgaccaaggggtgatctcgccc
gatgaccgggtcgtttgcatcctgaccggacatcagctgaaagatcccaccgcaacggtg
gcctatcacacgaccgatcaagacaagttcaacgaagtgcttggcagccgcggagttaaa
cgcgccagctttgccaatcgcgcggtcgcagttcccaacgatttgggcgagatcgtgaaa
gccattcagctttattcttag

DBGET integrated database retrieval system