KEGG   Pirellula staleyi: Psta_0766Help
Entry
Psta_0766         CDS       T01147                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
psl  Pirellula staleyi
Pathway
psl00010  Glycolysis / Gluconeogenesis
psl00030  Pentose phosphate pathway
psl00051  Fructose and mannose metabolism
psl00052  Galactose metabolism
psl00680  Methane metabolism
psl01100  Metabolic pathways
psl01110  Biosynthesis of secondary metabolites
psl01120  Microbial metabolism in diverse environments
psl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psta_0766
   00030 Pentose phosphate pathway
    Psta_0766
   00051 Fructose and mannose metabolism
    Psta_0766
   00052 Galactose metabolism
    Psta_0766
  Energy metabolism
   00680 Methane metabolism
    Psta_0766
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psta_0766
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Psta_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADB15451
UniProt: D2R673
Position
complement(937580..938758)
Genome map
AA seq 392 aa AA seqDB search
MAERTKRIGVLTAGGDCPGLNAVIRGVVKSANTHGYEVVGFLKGYEGLVDPVSYVPLTAK
NTAGILQQGGTILGSTNKGRFAATVGVNDRLELDPELVAGVKTTMEQLNICGLVCVGGDG
SLAVSQQFHEQGIPVVGVPKTIDNDLSSTAFTFGFFSAVFCATDALDRLHTTAASHERVM
VLEVMGRHAGWIALYAGIAGGGDVILIPEISWSFESVCQAVLAREQQGKKFTLIVVAEGA
ELPEGGLVTKDAHSLQKQVRLGGIGNVVASEIEKRIGKETRTVVLGHLQRGGSPTTFDRV
VATQFGAHAVRLIVEKKFGHMVCYQPPAMESVPIIDAIQLSTVHPMCSAVLAARALGVSF
GDNHTEPPFKYQPEAEACAAENGIAPQHAETH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaagaacgaagcggattggtgtgctgacagctggtggcgattgccccggtctc
aacgcggtgattcgtggcgtggtgaagtcggccaacacgcacggctatgaagtcgtcggg
ttcctcaaagggtacgaagggctcgtcgatcccgtcagctacgtgccgctgaccgccaaa
aacacggcggggattttgcagcaaggtggcaccatcctcggctcgaccaacaaaggtcgg
tttgccgccaccgttggggtgaacgaccgactcgagctcgatcccgaactggtcgcgggc
gtgaagaccacgatggagcagctgaacatctgtgggctggtttgcgtcggtggcgatggt
tcgctcgccgtgtcgcagcagtttcacgaacaaggcattccggtcgtcggtgttcccaag
acaatcgacaacgatctttcgagcaccgcgtttacgttcggtttctttagcgccgtgttc
tgcgcgaccgatgctctcgatcgactccataccaccgccgctagtcacgagcgcgtgatg
gtgctggaagtgatgggacgccatgcgggctggattgcgctctacgccggcatcgccggt
ggtggcgacgtgattctgatccccgaaatcagctggtcgtttgaaagtgtttgtcaggcg
gtgctcgctcgcgaacagcaggggaagaagttcaccctcatcgtggtggccgaaggggcc
gagcttcctgaaggtgggctcgtcacgaaagatgcccattcgctgcaaaagcaggtccgc
ctcggtggcattggaaatgtggtcgcctcggaaatcgaaaagcggatcggtaaagagacc
cgcacggtggtcctcggacacttgcagcgcggtggatcccccacgacgttcgatcgcgtc
gtggccactcagtttggcgcgcatgccgtgcggctgatcgtggagaagaagttcggccac
atggtttgctatcagcctccagcgatggagagtgtgccgatcatcgacgccattcagctc
agcaccgtgcatccgatgtgctcggctgttctggctgctcgcgcactgggagtgagcttt
ggtgacaaccacaccgagcccccgtttaagtatcagcccgaagcggaagcatgtgccgct
gaaaacggcatcgccccgcagcacgccgaaacccactaa

DBGET integrated database retrieval system