KEGG   Pirellula staleyi: Psta_0874Help
Entry
Psta_0874         CDS       T01147                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psl  Pirellula staleyi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Psta_0874
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psta_0874
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Psta_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081301..1081882
Genome map
AA seq 193 aa AA seqDB search
MNRLSTLLLTGIVAACISASFADAEEKNVSDNGALGFTVKSIAGKEVDLAKYKGKVLVVV
NVASACGLTPQYEELQALHTKYADKGLAVLGFPCNQFGKQEPGSDAEIAEFCKSEYNVSF
DMFSKIDVNGETANPLYKYLTSADSAPAAKGKISWNFEKFIIGKDGKVAARFSPRTAPDD
AEFIKAIEAELAK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgattgagcacccttctgttgaccggtattgtcgccgcttgcatttcagcaagt
ttcgccgacgccgaggagaaaaacgtgagcgataacggagccctcggcttcaccgtgaag
agcattgccggcaaagaggtcgacctcgccaagtacaaaggcaaagtactggtggtggtg
aatgtcgccagcgcttgcggtttgacaccgcagtacgaagaactccaagccctccacacc
aagtatgccgacaaaggtctggcagtcctcggtttcccttgcaatcaattcggtaagcaa
gagcccggcagcgatgccgagatcgccgaattctgcaaatcggaatacaacgtctcgttc
gacatgttctcgaagatcgatgtgaatggcgaaactgccaatcccctctacaagtacctg
acgagcgccgattcggcccctgctgccaagggaaagatcagctggaacttcgaaaagttc
atcatcggcaaggatggcaaagttgccgcccgcttctccccccgcaccgcccccgatgac
gccgagttcatcaaggccatcgaagccgaactcgcaaagtag

DBGET integrated database retrieval system