KEGG   Pirellula staleyi: Psta_0909Help
Entry
Psta_0909         CDS       T01147                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psl  Pirellula staleyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1136327..1137829)
Genome map
AA seq 500 aa AA seqDB search
MSTWLSFVITLLAALGAVAVVLALVRRRRPVGDIEAEQHLARETIARLQDLTARVAADVD
EHATYVQEINAELSGGEQDSDVLTTVQRLIDANERMQKQLVSAEERLQAQARQIESHAVE
ARTDALTQVANRRAFDDELRRCLSERDHNKTVSTLMILDVDHFKKFNDTHGHQAGDEVLR
GVARVLRNAFSSAELVARYGGEEFAIVFPGVSFAACQISAEKARQAVATANFRFQGKSLS
VTASAGLSELLPTDNEQEWIRRADEALYASKKAGRNCGHMTNAERTVRLTINDPAAVAAQ
TAAAEMSVAKVGDEWLFEADTNELFTRDPIANVSSRPVFFDDLIRRLAQWRRGGAPLSLM
MVQVDGLMRVATEHGPTAAATVLRVTSQIMQATMRDMDHVTRLGEDTFALLLPGAKIIDA
HSVSERLRAAVQKCRLPRRAGAAWFTITVGAVEVSNGDDMRLILERARRALQAAIAQGRN
CVIAHDSTGAPIVRMVPSNR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctggttgagcttcgtcatcactctcctcgcagcgcttggcgctgtcgcggtg
gtgctcgcattggtgcgacgacgaaggcctgtcggcgatatcgaagctgaacaacatcta
gcgcgagagacgatcgctcgcttgcaagatctcaccgcgcgggtcgctgccgatgtcgat
gagcacgctacctatgttcaagagatcaacgccgaactgagtggcggcgagcaagatagt
gatgtcctcaccaccgttcagcggctgattgacgccaacgagcggatgcaaaagcagctc
gtatcggcggaagaacgactgcaggctcaagcgcgacaaattgaatcgcatgcggtcgaa
gcccgcaccgatgctttaacgcaagtggccaatcgtcgcgccttcgacgacgaactccgc
cgctgccttagcgaacgagatcacaataaaaccgtctcgacgctgatgattctcgacgtc
gaccacttcaagaaattcaacgacacccacggtcatcaagcgggcgatgaagtgctccgc
ggggttgcccgtgtacttcgcaacgcattcagctcggctgaacttgtggcccgctacggt
ggtgaagaatttgccattgtgtttccgggtgtgtcgttcgcagcgtgccaaatctctgct
gaaaaagcgcgtcaggcggtggccacggccaactttcgttttcaaggcaagtcgctcagc
gtcaccgcgtcggctggcctgtcggaattgctgccgaccgataacgaacaagaatggatt
cgtcgcgccgacgaagcactctacgcgtcgaagaaggcgggtcgcaactgcggccacatg
accaacgccgagcggactgttcgactcaccatcaacgatcccgcagcggtcgccgcacaa
acggctgctgccgaaatgtcggttgcgaaggtgggagatgaatggctctttgaagccgac
accaatgagcttttcacacgagatccgattgcgaacgtttcgtcgcgtcctgtgttcttt
gacgatctgattcgtcggctggctcagtggcgacgtggcggcgcgccactttcgctcatg
atggtgcaagtcgatggtttgatgcgcgtggcgaccgaacatggtcccacagctgcggcc
accgttttgcgagtgacgtcgcagatcatgcaagcgacaatgcgcgacatggatcacgtg
acacgtctgggcgaagataccttcgcgctgttgctgccaggtgccaagatcatcgatgct
cactcggtgagcgaacgccttcgagcagccgtacaaaaatgtcgtttgccacgtcgtgct
ggagccgcctggttcaccatcaccgtgggtgcggtcgaggtgagcaatggggacgacatg
cggctgattctcgagcgtgcccgtcgcgctctgcaagcagcgattgcgcagggtcgcaac
tgcgtgatcgcccatgatagcactggggcaccgatcgttcgtatggtcccctcgaatcgt
tag

DBGET integrated database retrieval system