KEGG   Pirellula staleyi: Psta_2339Help
Entry
Psta_2339         CDS       T01147                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psl  Pirellula staleyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3055888..3056463
Genome map
AA seq 191 aa AA seqDB search
MKSPVDLQRIERAVREILAAVGEDPDREGLLETPARVARMYAEMFSGLKLDPREHTRKFF
TEQYDEVVLVRDISFCSMCEHHLLPFIGHAHVAYIPNGKVIGLSKIARVVEVISRRPQVQ
ERMTEDIANLLVDELHAKGVAVVVEASHSCMTIRGVRKPGSSMVTSAMKGLFRSNLSTRA
EVMQLIYGSKR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcccgtcgatctgcagcggatcgagcgcgcggtacgcgaaatcctggcggct
gtgggagaagatcccgatcgcgaagggctcctcgaaacgcctgcccgtgtcgctcgcatg
tatgcagagatgttcagcgggctgaagctcgatccccgcgagcacacgcgtaagttcttc
accgaacagtacgacgaagtggtgctggtgcgcgacatcagcttctgcagcatgtgcgaa
catcacctgctgccgttcatcggtcatgcccacgtcgcttatatccccaatggcaaagtg
atcggcctctcgaagatcgctcgcgtggtggaagtgatttcgcgacgcccccaagtgcaa
gagcgaatgaccgaagacattgcgaacctgctggtcgacgaattgcacgccaaaggtgtg
gctgtggtggtggaagcatcgcacagctgcatgacgattcgaggggtccgtaaaccagga
agctcgatggtcacctcggccatgaagggcttgttccgatcgaacctttcgacccgtgcc
gaagtgatgcagctgatctacggcagtaagcgataa

DBGET integrated database retrieval system