KEGG   Pirellula staleyi: Psta_2483Help
Entry
Psta_2483         CDS       T01147                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
psl  Pirellula staleyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psta_2483
   01230 Biosynthesis of amino acids
    Psta_2483
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psta_2483
   00030 Pentose phosphate pathway
    Psta_2483
   00051 Fructose and mannose metabolism
    Psta_2483
   00052 Galactose metabolism
    Psta_2483
  Energy metabolism
   00680 Methane metabolism
    Psta_2483
Enzymes [BR:psl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Psta_2483
Protein phosphatases and associated proteins [BR:psl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Psta_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3223447..3224736
Genome map
AA seq 429 aa AA seqDB search
MSQPKNMVVAQSGGPSPVINNTLRGIVEAARNYANIGTVYGARHGIEGVLKEELLDLSSQ
HPDEISLLRYTPAAGSIGTCRYKLKPNQTEDFERVIEVLKAHNVGYFVYIGGNDSMDTAN
KVAKLAHERGLDLIGIGGPKTIDNDVGDSEFKLIDHTPGYGSCAKYWMHAVQNANEENQG
SCPADPVLVMQAMGRKIGFIPAAARLADPHREMPLQIYLAESPCSLEQLADNVNDQLKRD
GRCMVVISEGFNVGSLGERRDSFGHVQFSSSETTVAQTVVNYLNSKGLAAKGAARGNVPG
TDQRHSMAYASTVDLDEAYRAGEMCAHLATTGQSGYMATILRNEGSIYSVRYDKAPLELV
ANSERMFPKNWITAAGNDVTDDFIRYAKPLVGEGMLSLPMVDGRQRLTRLEKKYATQKLA
KYIPQADRK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgaagaacatggtggtcgcccagagtggcggacccagccccgttatcaac
aacaccttgcgaggcattgtcgaagccgctcgcaactacgcgaacatcggcacggtctac
ggtgcccgccatggtatcgagggggttctgaaggaagaactgctcgacctctcgtcgcag
catcccgacgaaatctcgctcctccgctataccccagctgccggttcgatcggcacctgt
cgctacaagctcaagccgaaccagaccgaagatttcgagcgcgtgatcgaagtcctcaaa
gctcacaacgtgggctactttgtctacatcggcggcaacgattcgatggacaccgccaac
aaggtcgccaagctcgcccacgagcgcggactcgatctcatcggcatcggtggacccaag
accatcgacaacgacgttggcgatagcgaatttaagctcatcgaccatacgccgggctac
ggcagctgtgccaaatactggatgcacgccgttcaaaacgcgaacgaagaaaatcagggc
tcctgcccagccgacccggtgctcgtgatgcaagcgatggggcgcaagatcggcttcatc
ccagccgccgctcgtctagccgatccgcaccgcgaaatgccgctgcagatctatctggcc
gagagcccatgctcgctcgagcagttggccgacaacgtcaacgatcagctgaagcgagat
ggccgctgcatggtggtgatcagcgaaggctttaacgtggggagtctcggcgaacgtcgt
gactcgtttggtcacgtgcagttcagttcgagtgaaaccaccgtggctcaaaccgtggtg
aactacctgaactcgaaggggctcgctgccaagggagccgctcgcggcaatgtcccgggg
accgatcagcgtcactcgatggcgtatgcctcgacggtcgatctcgacgaagcctaccgg
gccggcgagatgtgtgcgcacctcgccaccaccggccaaagtggctacatggcgacgatt
cttcgcaacgaaggttcgatttacagcgtgcggtacgacaaagctccgctggaacttgtc
gccaacagcgaacggatgttccccaaaaactggatcaccgccgcaggtaacgacgtcacc
gacgactttattcgctacgccaaaccgctcgtgggcgaagggatgctcagcctcccgatg
gtcgacggccgccaacgcctcacccgcctcgagaaaaaatacgcaactcaaaagctcgcc
aagtacattccccaagcggatcggaagtag

DBGET integrated database retrieval system