KEGG   Pirellula staleyi: Psta_2515Help
Entry
Psta_2515         CDS       T01147                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psl  Pirellula staleyi
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Psta_2515
Enzymes [BR:psl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Psta_2515
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Psta_2515
Lipid biosynthesis proteins [BR:psl01004]
 Fatty acid synthase
  Component type
   Psta_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3266401..3267138)
Genome map
AA seq 245 aa AA seqDB search
MFHPPLLRSWPVLVVAGWLAATATLHAQEQPKAKGKGATGAMAPIDDVAGLPRVLLIGDS
ISIGYTLPVRELLKEKANVHRPLTNCSSTQNGLTNLDAWLGKKKWDVIHFNFGLHDAKLP
PEGVRHAPPDVYEANLRAVVKKLKATGAKLIWGTTTPVPNGGVISPTRRFGSIDEYNAIA
QRVMEENGVEINDLSATITPHLKTAQIPSDVHFTKEGSQLLADQVAQVIEQALGTSAADN
KPDTK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacccacccttgctccgaagctggcccgttcttgtcgtcgccggttggctcgcc
gccacagccactctccacgcccaggagcagccgaaagcgaaaggcaaaggagcaaccggc
gcaatggcaccgatcgacgatgtcgcaggacttccgcgcgtgctgctgatcggcgattcg
atttcgattggttacaccctgccggtgcgggaactgctcaaggagaaagcgaacgttcat
cggccacttacgaactgcagcagtacgcaaaacggactaacaaatctcgacgcttggctc
ggtaaaaagaagtgggatgtgattcactttaacttcggcctacacgatgccaagttgcct
ccggagggtgtgcgccacgcccctcccgatgtttacgaagcgaatcttcgggcggtcgtg
aaaaagttgaaagcgactggcgcgaagctcatttgggggaccacaacaccggttcccaat
ggaggtgtgattagccccacgcggcgtttcggcagcatcgatgagtacaacgcgattgcc
cagcgcgtgatggaagaaaatggtgtcgagatcaacgacctcagcgccacgattaccccc
catctcaagacggcgcaaatcccaagcgatgtccacttcaccaaagagggctcgcagctt
ctggccgatcaagtggcccaagtgatcgagcaagcactcggcacttcggcagcggataac
aagccagatacgaaataa

DBGET integrated database retrieval system