KEGG   Pirellula staleyi: Psta_2633Help
Entry
Psta_2633         CDS       T01147                                 

Definition
chorismate-binding protein
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
psl  Pirellula staleyi
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3397462..3398883)
Genome map
AA seq 473 aa AA seqDB search
MNSNSFSHEPIVLELPNAPAVDVALRRIAHLPRCLLLDSALRDPKLGRYSFLTADPFQRL
TSEGAEDGLTKLASVLSQFPAPTVAGLPPFQGGAAGLLAYDLVQSLERIPLRRHPFFSLP
TLSIGLYDTVIAWDHLLGKTWIISHGFSAEQPPSQKRAQDRLDYFRAMLCGEYKGDGSQQ
SLRVSTVERPAIAGQWSAPQLEGLLSNFTPQGYLAAVERAIEYILAGDVFQVNLSQRLLF
PAISSALDLYLRLRERNAATFAGYYDLGDQQIVSASPERFVKVSGQQVEARPIKGTRKRT
FRAEADLFAGDDLLASEKDRAENTMIVDLLRNDLSQACDSESLHVSQLCGLEIYQFVQHL
VSVVEGKLSPGKSALDLTRHAFPGGSITGAPKVRAMEIISELEPDPRGAYCGSLGYFGFD
GSMDLSILIRTITASSGWWQFPVGGGIVAQSVPELEYAETWHKAAGILSSLLP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcaaactcattttctcacgaaccaatcgttcttgaattacccaatgctccagcg
gtcgatgttgcgctccgtcgcatcgcgcacctacctcgatgtttactgctcgatagtgcg
ctgcgtgatcctaagctgggacgttattcgttcctgactgccgatccgtttcaaaggttg
acttctgaaggtgccgaagatggcttaacgaagctagccagcgtgctctcgcaatttcca
gcacccacggtggcgggactaccaccgtttcaaggtggtgcggctggccttcttgcctac
gacctggtccaaagcctcgaaagaattccactccgccgacatccttttttttcgctcccc
acactctcgatcggactctacgacacggtgatcgcctgggatcacttgctcggcaaaacc
tggattatctcgcacggatttagcgccgagcagcctccctcccagaagcgtgctcaagat
cgactggactatttccgagcgatgctctgcggcgaatacaaaggcgatggtagccagcaa
agcttgagagtgtcgacagtggagcgaccagccatcgcaggacagtggtcggcgccacaa
ctcgaaggactgctgagcaacttcacaccccagggataccttgccgctgtcgagcgggcc
atcgaatacatcttggcgggggatgtctttcaagtgaacttgtcgcagcgtctactcttt
ccggcgatcagttcagctctcgatctctacctccgcctgcgtgagcgaaatgccgcaact
ttcgctggatactacgatctgggcgatcagcagatcgtcagcgcgtcgccagaacgtttt
gtgaaagtgtccggtcagcaggtcgaagcgcgtccgatcaaagggacccgtaaacgaact
ttccgcgcagaggccgatctatttgcgggagatgatctcctcgccagtgaaaaagatcgt
gccgaaaacacaatgatcgtcgacctgctgcgaaacgatctgtcccaggcgtgcgacagc
gagtcgctccatgtctcgcagctgtgcggcctggaaatctatcagttcgtgcaacacctg
gtttcagtggtagaaggaaaattatcgcccggcaaatcggctctggacctaactcggcat
gctttccctggtggttctattactggtgcccccaaagttcgtgcgatggagatcatcagc
gagctagagcccgatccgcgcggggcctactgcggctcgctcggctattttggtttcgat
ggcagtatggatctcagcattctgattcgaaccatcacggcatccagcggctggtggcaa
tttcctgtgggtggaggcatcgtggcgcaatcggtacccgaactcgagtatgctgaaacc
tggcacaaagcggccggtattctctcgtcgctactaccttaa

DBGET integrated database retrieval system