KEGG   Pirellula staleyi: Psta_2687Help
Entry
Psta_2687         CDS       T01147                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psl  Pirellula staleyi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psta_2687
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psta_2687
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psta_2687
Enzymes [BR:psl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psta_2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3465786..3467015)
Genome map
AA seq 409 aa AA seqDB search
MPRFVTHLEGAIDGERLDADKIASLHRDRPILVRYDLEAVRAAVTPDQLRARPWSMWRYR
ELLPYFDDADVVSLGESITPILPCPRLASDLGLDRLWIKDESQLPTGSFKSRGLAMAITM
ARRFGVQRVALPTAGNAGGAAAAYAARAGLECYVFMPEDTPIINQLECKLAGAKTFLVNG
LINDCGKIVRQGQQTMGWFDLSTLKEPYRLEGKKTMGLELAEQCNWKLPDVIVYPTGGGT
GLIGMWKAFQELAALGWISSEKFPRMVSVQSSGCAPIATAYDKNERFAELFPNAHTVASG
LRVPVAVGDFLILDAVRQSGGTALAVAEETLLDWQRMAVRQEGIALCPESAACVAAVAQL
TSSGWIGRSEDVVIFNTGAAQKYVEAMQAPLASLDISLPLDWEKIAKTT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctttgtaactcacctcgaaggcgctatcgacggcgagcgcctggatgccgac
aaaatcgcttccctgcatcgcgatcgccccattttagtccgttacgatttggaagctgtt
cgcgccgcagtcacgcccgatcaacttcgcgcgcgaccttggtcgatgtggcgctaccgc
gaactcttgccttatttcgacgatgccgatgtcgtttctctcggcgaatcgattacaccg
attcttccctgccctcgactcgccagcgatctcgggctcgatcgcctctggatcaaggac
gaatcgcagctcccgaccgggagcttcaagagccgcggcctcgcgatggccatcaccatg
gcgcgccggttcggcgtgcagcgtgtggcgctgccaactgctggaaatgccggtggagcc
gctgctgcgtacgccgctcgagccggtctcgaatgctatgtcttcatgcccgaagatacc
ccgatcatcaaccagctcgaatgcaaactggcaggggccaaaaccttcctggtaaatggg
ctgatcaacgactgcggcaagatcgttcgccaaggtcagcagacgatgggctggttcgat
ctctcgaccctcaaagaaccgtatcgtctcgagggcaaaaagacgatgggtctcgaactg
gccgagcagtgtaattggaaattgcccgacgtcatcgtttatcccaccggaggcggcacg
ggactcattgggatgtggaaagcgtttcaggagttggccgcgctggggtggatctcgagc
gaaaagtttccgcgaatggtgagtgtgcaatcctcgggctgtgcccccatcgccacagcc
tacgacaagaacgagcggtttgccgaactgtttcccaacgctcacaccgttgcgagtggg
ctgcgagttccggtggccgtgggagactttctgattctcgacgcggtccgtcaaagtggc
ggcactgcgctcgcagtggccgaggaaacactcctcgactggcaacgaatggccgttcga
caagagggtatcgccctttgccccgaaagtgcggcctgtgtcgcagccgtggcgcagctc
accagcagcggctggattgggcggagcgaagatgtggtgatcttcaataccggcgctgcc
caaaagtatgtcgaagcgatgcaagcgcccctcgcatcactcgacatcagcttacccctt
gactgggaaaagattgcgaagaccacttaa

DBGET integrated database retrieval system