KEGG   Pirellula staleyi: Psta_2811Help
Entry
Psta_2811         CDS       T01147                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psl  Pirellula staleyi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psta_2811
Enzymes [BR:psl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Psta_2811
Exosome [BR:psl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psta_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3640880..3641896
Genome map
AA seq 338 aa AA seqDB search
MKSEDSKPASGFPITRMRRLRYHPAVRSLVRETKLTPSQMILPLFARPGKGLRQPISSMP
PHCQLSVDLIAEEAREAAKLGLGGILLFGIPSEKDGCGSDSYSDNGIVQQAIRAAKEAAP
DLLVVTDVCFCEYTSHGHCGIVDDHTGRMDVNNDATLEIIAKQVVSHAQAGADMVAPSGM
MDGMIGTIRSALDGAGFHHLPIMSYAAKYASSYYGPFREAAESTPQFGDRRAYQMDPAVA
AEQALRECELDLAEGADMLMVKPALAYLDIIRAVHEKFPGVPLAAYNVSGEYSMVKAAAE
KGWIDERGVALETLTAIARAGAKIIITYWAKDVAKWLA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgaagattccaaaccggcgtcggggtttcccatcactcgcatgcgtcgactg
cggtaccatcccgcagttcggtcactcgtgcgcgagaccaaactgacaccaagtcaaatg
atcctgcctctttttgcccgtccggggaaggggttgcgacaaccaatttcgtcgatgccg
ccccattgtcagctgagtgtcgacttgattgccgaggaagcgcgcgaggcggcaaagctg
gggctcggcgggattctgctgttcggcattccatcggaaaaagatggatgcggcagcgat
tcctatagcgacaatgggattgttcagcaggcgattcgggctgctaaagaggctgccccc
gatctgctggtggtcaccgacgtttgcttctgcgagtacaccagtcatggccactgcggc
atcgtcgacgaccataccggccggatggatgtgaataacgatgcgaccctcgagattatt
gccaaacaagtggtgagtcatgctcaggccggggccgatatggtggcaccgagcgggatg
atggatgggatgattggcaccattcgctcggcactggatggagcaggttttcatcacctg
ccgatcatgagttatgccgcgaagtatgccagcagctattacggaccgtttcgcgaagct
gccgagagcaccccgcagtttggcgatcgccgcgcctatcaaatggaccccgccgtggca
gccgagcaagcgctgcgtgagtgcgaactcgatctagccgagggggccgacatgctgatg
gtcaaaccggcgctcgcttacctcgatatcattcgtgcggtgcacgaaaaatttccgggc
gtgccactagcggcctataacgtctcgggcgaatacagcatggtgaaagcggcggccgaa
aagggttggatcgacgagcgcggcgtcgcgcttgagactctcacggccattgctcgtgcc
ggcgctaagatcatcatcacttactgggccaaagatgtggccaagtggctcgcttaa

DBGET integrated database retrieval system