KEGG   Pirellula staleyi: Psta_2832Help
Entry
Psta_2832         CDS       T01147                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psl  Pirellula staleyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psta_2832
Enzymes [BR:psl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Psta_2832
Exosome [BR:psl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psta_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3664472..3666709)
Genome map
AA seq 745 aa AA seqDB search
MRTSVTLEGVAALLDGTIENPNTVLGPQEIEHEGRRALAVRAFLPDSKQAWVVDSSHQMS
RPMRRIHPAGLYEAICPLPEDRTWPPYQLRVASEGGEMTTLHDPYAFEPYLTDFDRYLFG
KGELLRAHDKFGAQLREVSGVKGTNFALWAPNAQSVSVVGDFNQWDGRRHPMKRAASGGV
WELFVPALDAGQKYKFRVKSRWGEVIDKSDPFGFAAELPPSTASIVTDLTRHHWNDDAWM
EKRKNSNYLHEPMSVYEVHLGSWRRSAHRTHGWLSYRDLAHQLVAYCKEMNYTHLELLPI
SEHPYTGSWGYQTVGYFAATSRYGTPEDFMYFVDYCHQNDIGVILDWVPAHFPKDAHGLR
RFDGTALYEHEDPRKGEHPDWGTMIFNYGRCEVKNFLLANALFWLEKYHIDGLRVDAVAS
MLYLDYSRKEGEWVPNIHGGRENLEAISFLRDFNIQTHKYHPGVMTIAEESTAWGGVSRP
TDVGGLGFSIKWNMGWMNDTLRFMKQDPIHRRHHHDQLTFSLIYAYTENFALPLSHDEVV
HGKKSLLDQMPGDLWQKFANLRLLYAYMWTHPGKKLLFMGCEFGQWNEWNHDSELQWDLL
QWETHGGVKQLMSDLNKLLIHEPAMHELDFDPAGFEWIDCNSRDESILSYVRKAKDGDDC
LVVCCNFTPVPRKNFALGVPFAGWYDEVLNTDSKFYGGSNVGNISGALAEAPGWHGRPAK
ITINVPPLGVVVFKPRYEQTTPPVE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaccagcgtaacactcgaaggtgtagcagccttactcgacggaacgatcgaaaac
cccaacacggttctggggccgcaagagatagaacatgaaggacgccgggctttggcggtg
cgggcgttccttccggatagtaaacaggcctgggtggtggatagttctcaccaaatgtcg
cgacctatgcgacgcattcaccctgcaggtctctacgaggcgatttgcccactccctgag
gatcgcacctggccgccgtatcaacttcgcgttgcaagcgaagggggcgagatgacgacg
ctgcatgatccttatgcctttgagccctacctcaccgatttcgatcgctatttgttcggc
aagggggaactgctcagggcccacgataaattcggggcgcagctgcgcgaagtctctggg
gttaaagggacgaactttgctctgtgggctcccaatgcccaaagcgtgagtgtggttggc
gatttcaaccagtgggatggtcgccgtcatccgatgaagcgcgccgccagtggcggtgtg
tgggaactttttgtccccgcgctcgacgcaggtcaaaagtacaagttccgcgtgaagagc
cgctggggcgaagtgatcgacaagagcgatccctttggatttgccgctgaacttccgccg
agcaccgcttcgatcgtcactgatctcacgcgtcatcactggaacgatgatgcctggatg
gagaaacgcaagaacagcaactatctgcacgagccgatgtcggtctacgaagtgcacctc
ggaagttggcgccgcagtgcacatcgcacgcacggctggctgtcgtatcgcgatctcgcg
catcagctcgtcgcctactgcaaagagatgaactacacccatctcgagttgctaccgatc
agcgagcatccttacaccggcagctggggctatcaaacggtcggctacttcgccgccacc
agccgttatggcactcccgaagacttcatgtacttcgtcgactactgccatcaaaacgac
attggtgtgatcctcgactgggtccccgcgcactttcccaaagatgcgcacgggctgcgt
cgtttcgatggcaccgcgctctacgaacacgaagatccccgcaaaggcgagcaccccgac
tggggaacgatgatcttcaactatggccgctgcgaagtgaaaaacttcctgctcgccaac
gctctcttctggctcgagaagtatcacatcgatggactgcgcgtcgacgccgtcgcttcg
atgctctacctcgactacagtcgcaaagagggcgaatgggtccccaacattcatggtgga
cgcgagaatctcgaagcgatttcgttccttcgcgatttcaacattcaaacacacaaatat
caccctggggtgatgacgatcgccgaggagagcactgcttggggtggcgtatcgcgccca
accgatgtgggtggcttgggctttagcatcaaatggaacatggggtggatgaacgatacg
cttcgcttcatgaagcaagatccgattcatcgccgccaccatcacgatcagctaaccttt
agcctgatctatgcctacaccgagaacttcgcactcccactgtcgcacgacgaagtggtg
catggcaaaaagtcgctgctcgaccagatgccaggcgacctgtggcagaagtttgccaac
ttgcgtttgctctacgcctatatgtggacgcatccaggcaaaaagctgctgttcatgggc
tgcgagttcggccagtggaacgaatggaaccacgacagcgaattgcagtgggacctgctg
caatgggaaacccacggcggtgtgaagcagctaatgtcggacctcaacaagctgctgatt
cacgaaccagcgatgcacgaactcgatttcgatcccgctggttttgaatggatcgactgc
aacagccgcgacgaaagcattctctcctacgtccgcaaagcgaaggatggagacgactgc
ctggtggtctgctgcaactttaccccagtgcctcggaagaattttgccctgggtgtgccg
ttcgctgggtggtacgacgaggtgctcaacaccgactcgaagttctatggcggcagcaac
gtggggaacatcagcggcgcgttggcagaagctcccggctggcacggccgccccgccaaa
atcaccatcaacgttccaccactaggcgttgtagtcttcaaacctcgctacgagcaaacg
actccaccggttgagtaa

DBGET integrated database retrieval system