KEGG   Pirellula staleyi: Psta_2895Help
Entry
Psta_2895         CDS       T01147                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psl  Pirellula staleyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3750896..3752116)
Genome map
AA seq 406 aa AA seqDB search
MLLLAAMPATAQTKAQYDAARNFMVKEVIVGSGIKDERVIQSMRDTLRHEFVTITHRKNA
YLDMALPIGDSQTISSPFIVAYMTESLQPQATDKVLEIGTGSGYQAAILSPLVKEVYSIE
IVDSLGKNAAKTLTRLGYKNVFTKVGDGYLGWEEHAPFDKIIVTCSPEKVPKPLEDQLVE
GGLMVVPVGQRYEQTLYLFRKRNGKLESEALLPTLFVPMTGKAEDNREIKPDPANPRCAN
GSFEQEAFPAGGQPGWYYERNIRWETDENSPDGKHHVSFTNSVPGLSSHLLQGFAIDGRK
VPELEMKGWVKTDNVIDGPGRDDIAYIIVTLYDENRRQMGHHLLGPFRGTHDWAEKSKKI
RIPAQTREGVLRIGLFGATGTASFDGISLQKVVAEIPETSETPSAP
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgttggctgccatgccagcgacggcacaaacgaaagcgcagtacgacgccgcc
cgcaatttcatggtgaaggaagttatcgttggttcggggatcaaagacgaacgtgtgatt
cagtcgatgcgcgacacgctgcggcacgaatttgtcacgatcacgcaccgtaagaatgcc
tacctcgacatggcgttgccgatcggcgattcgcaaacgatcagcagtccgtttatcgtg
gcctacatgaccgagtcgctgcagcctcaagcgaccgacaaggtgctcgaaatcggcacc
ggctcgggttatcaagcagccatcttgagtccgctcgtcaaagaggtgtactcaattgaa
attgtcgattctctcgggaaaaacgctgccaaaacccttacgcggctgggctacaaaaac
gtctttacgaaagtgggtgacggttatctgggatgggaagaacacgcgccgttcgacaaa
attattgttacctgctcacccgaaaaagttcccaaaccactggaggatcaactggtcgaa
ggtgggctgatggtggttcctgtgggacagcgttacgagcagacgctctacctgtttcgc
aaacgcaatggaaaactcgaatccgaagcgctcctccccaccctgtttgtgccgatgacg
ggcaaagccgaggacaaccgggaaattaagcccgatccggcgaatccccggtgcgcgaac
gggagtttcgaacaggaagcgtttccggcaggtggtcagcctggctggtattacgagcgg
aatattcgatgggagaccgacgagaattcccccgacggaaaacaccatgtgagcttcact
aattccgttccaggcttaagctcgcacttgctgcaaggatttgccattgatggtcgtaag
gtccccgaactggagatgaaggggtgggtgaagaccgacaacgtgatcgacggcccaggt
cgagatgacattgcttatattattgtgacgctttacgacgagaatcgtcggcaaatgggg
catcacttgctgggcccctttcgcggcacacatgactgggccgagaagagtaagaagatt
cgcattccagcgcaaacacgcgaaggtgtattgcgaatcggtttgttcggcgcgacgggg
acggcgagcttcgatgggatttcgctgcaaaaagtagttgcggaaatccctgaaacctca
gagactccatcagccccctaa

DBGET integrated database retrieval system