KEGG   Pirellula staleyi: Psta_3125Help
Entry
Psta_3125         CDS       T01147                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
psl  Pirellula staleyi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:psl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4034753..4035355)
Genome map
AA seq 200 aa AA seqDB search
MPSETPTPAPAHGYLVVISGPSGAGKSTVVHEVLAKCPLPLELSVSATTRKPRPGEVDGV
HYHFLSHDEFRTRREQGEFLECKEVFGRGDWYGTLQNTVSTGLAAGKWVLLEIDVEGMLA
VLQKFPQAETIFIHSGSIEELERRLRQRNTETEDSLARRLEVARRELTFLSHYRHQVINH
DLDTAVADVCRILTSLAARP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgaaacacccacccccgctcctgcccacggctatctcgtggtgatttccggc
cccagcggcgccggcaagagcacggtggtccacgaggtgctcgcgaagtgcccactgcca
ctggagttaagtgtttcggcgacgacccgcaaaccacgtcctggcgaagtcgacggagtg
cactatcacttcctttcgcacgacgagtttcgcacgcgccgcgagcagggggaattcctc
gagtgcaaggaagtgtttggacgtggcgactggtacggcacgctgcaaaacacggtgagc
actggacttgcggccggaaaatgggtactcttagagattgatgtggaaggaatgctcgcc
gtcctgcagaaatttccgcaggccgagacgatcttcatccactccggttcgatcgaggaa
ctcgagcgacgcttacggcaacggaacaccgaaaccgaagactcgctggcacgtcgactg
gaagtcgctcgccgggaactcaccttcctgtcgcactaccgtcatcaggtgatcaatcac
gacctcgatacagcagtggctgatgtttgtcgcatcctgacatcgctggccgctcgccca
tga

DBGET integrated database retrieval system