KEGG   Pirellula staleyi: Psta_3140Help
Entry
Psta_3140         CDS       T01147                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psl  Pirellula staleyi
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4049920..4050498
Genome map
AA seq 192 aa AA seqDB search
MARIRIQDENREITGAEAIREFLKPFGIWYEKWDVAGRIGPDATNEEILAAYAPEIERLK
VAGNFVTADVINVNPGTPGLDGMLAKFCKEHTHSEDEVRFTVKGSGVFHIHPEGGPVFAV
QVEAGDLINVPMGTKHWFDLCSDKTIRCIRLFQDMSGWAPHYVESGVHERYQPLCMGPAY
LPAAGIDSVVKL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaattcgaattcaagacgagaatcgcgaaattaccggtgcagaagcgattcgc
gagtttctcaagccgtttggcatttggtacgagaagtgggatgtcgccggacggatcggt
cctgacgctacgaacgaagagatcctggccgcttatgccccagagatcgagcggctgaag
gtggccggaaattttgtgacagccgacgtcatcaacgtcaatcctggtacgcccgggctc
gatgggatgctcgccaaattctgcaaagaacatacccacagcgaagacgaagttcgcttc
acggtgaaggggagtggtgtgtttcacattcatcccgaaggtgggccggtttttgccgtc
caagtcgaagcgggggatttgattaacgttccgatggggaccaagcattggttcgatctc
tgcagcgacaaaacgattcgctgcattcgcctgttccaggacatgtcgggctgggcgccg
cactacgttgaatcgggtgtgcacgagcgctatcagccgctctgcatgggacctgcctat
ttgccagccgccggtatcgattcggtcgtcaagctgtag

DBGET integrated database retrieval system