KEGG   Pirellula staleyi: Psta_3140Help
Entry
Psta_3140         CDS       T01147                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psl  Pirellula staleyi
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psta_3140
Enzymes [BR:psl01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Psta_3140
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Psta_3140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4049920..4050498
Genome map
AA seq 192 aa AA seqDB search
MARIRIQDENREITGAEAIREFLKPFGIWYEKWDVAGRIGPDATNEEILAAYAPEIERLK
VAGNFVTADVINVNPGTPGLDGMLAKFCKEHTHSEDEVRFTVKGSGVFHIHPEGGPVFAV
QVEAGDLINVPMGTKHWFDLCSDKTIRCIRLFQDMSGWAPHYVESGVHERYQPLCMGPAY
LPAAGIDSVVKL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaattcgaattcaagacgagaatcgcgaaattaccggtgcagaagcgattcgc
gagtttctcaagccgtttggcatttggtacgagaagtgggatgtcgccggacggatcggt
cctgacgctacgaacgaagagatcctggccgcttatgccccagagatcgagcggctgaag
gtggccggaaattttgtgacagccgacgtcatcaacgtcaatcctggtacgcccgggctc
gatgggatgctcgccaaattctgcaaagaacatacccacagcgaagacgaagttcgcttc
acggtgaaggggagtggtgtgtttcacattcatcccgaaggtgggccggtttttgccgtc
caagtcgaagcgggggatttgattaacgttccgatggggaccaagcattggttcgatctc
tgcagcgacaaaacgattcgctgcattcgcctgttccaggacatgtcgggctgggcgccg
cactacgttgaatcgggtgtgcacgagcgctatcagccgctctgcatgggacctgcctat
ttgccagccgccggtatcgattcggtcgtcaagctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system