KEGG   Pirellula staleyi: Psta_3258Help
Entry
Psta_3258         CDS       T01147                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psl  Pirellula staleyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4214804..4215862
Genome map
AA seq 352 aa AA seqDB search
MEPVAYDFLRKLLDTPSPSGYERPIQDVVRSYVRDFADSVSTDLHGNVIAAKNPGAARRV
MFAGHCDQIGMLVTHINENGFIYAQTIGGWDAQQLIGQRMVIWTAEGPVPAVISRKPIHL
LSDEERKSVVKLDDLWLDIGARNKAEVAGIIKIGDPVTLELKYTEMRNKLASSPAMDNKV
GLWVCIEALRRASQQNLQVGVFAVSTVCEEIGLRGAQTSAFGVDPHIGIAVDVTHATDCP
TIDKRQQGDIALGSGPVIFRGPNMNPVVTAKLLSLAQEKMIPHQISASGRAVPNDANALQ
VNRAGVATGLVSIPNRYMHSAVEMVSLEDIDQAADLLAAFVISLEGTEDFTP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgtcgcctacgatttcctccgcaagttgctcgatacacccagccctagtggt
tatgagcgtccgattcaggatgtggttcggagttatgtccgcgactttgccgacagtgtc
tcgaccgacctgcacggaaatgtgattgccgcgaagaatccgggggcggctcgccgcgtg
atgttcgccggtcactgcgaccaaatcggcatgctggtgacccatatcaacgaaaacgga
tttatctatgcgcaaaccattggaggctgggatgctcagcagctgattggccagcggatg
gtgatttggaccgccgaggggcccgttccggccgtcatcagccgcaagccgatccactta
ctctccgacgaggaacgcaaaagtgtcgtgaaactcgacgatttgtggctcgatattggg
gcacgaaacaaggcagaagtggctggaatcattaaaatcggcgatccggtgacgctggag
ctgaagtacaccgagatgcgaaacaaactcgccagcagcccggcgatggacaacaaagtg
ggtctgtgggtctgtattgaagctctgcggcgcgccagtcagcagaacttgcaggtgggt
gttttcgcggtctcgaccgtgtgcgaagaaattggcttgcgaggggctcagacgtcggct
ttcggagtcgatccgcacattggtatcgcggtcgacgtgacccatgcgaccgattgcccc
acgatcgacaagcgtcagcagggtgatattgccctggggagtggtccggtcattttccgt
ggcccgaacatgaatcctgtcgtcacggcgaaactgctgagcctcgcccaggagaagatg
attccccaccaaatttcggccagcggccgagcagtgccaaacgatgccaacgccctgcaa
gtcaatcgcgctggcgtagcgaccggacttgtgagcattcccaatcgctacatgcattcg
gctgttgaaatggtttcgctcgaggatattgaccaggcggctgacctactggcagcgttt
gtaatttccctcgaaggaactgaggactttacaccctag

DBGET integrated database retrieval system